| Clone Name | baet119f07 |
|---|---|
| Clone Library Name | barley_pub |
>UPK3B_HUMAN (Q9BT76) Uroplakin-3B precursor (Uroplakin IIIb) (UPIIIb) (p35)| Length = 320 Score = 32.7 bits (73), Expect = 0.41 Identities = 20/61 (32%), Positives = 24/61 (39%) Frame = -3 Query: 317 DCSQPEQAQGGPAAVLSPWARRCLPDGR*SSLQEEHCPVRRSWRMGGSPAAISCASSLRP 138 D S Q GGPA V+ PWA P+R G+P +S A L P Sbjct: 36 DASSQTQGAGGPAGVIGPWA---------------PAPLRLGEAAPGTPTPVSVAHLLSP 80 Query: 137 V 135 V Sbjct: 81 V 81
>CABL1_MOUSE (Q9ESJ1) CDK5 and ABL1 enzyme substrate 1 (Interactor with CDK3 1)| (Ik3-1) Length = 568 Score = 31.6 bits (70), Expect = 0.91 Identities = 24/62 (38%), Positives = 31/62 (50%), Gaps = 7/62 (11%) Frame = -3 Query: 335 RSNHQEDCSQPEQAQGGPAAVLSPW--ARRCLPDGR*SSLQ-----EEHCPVRRSWRMGG 177 R N Q C+ + QGG + L ARR L R SSL+ EE+ P+RR + G Sbjct: 215 RQNSQNYCALEQSGQGGSTSALEQLQRARRRLISQR-SSLETLEDIEENAPLRRCRTLSG 273 Query: 176 SP 171 SP Sbjct: 274 SP 275
>ZIC5_HUMAN (Q96T25) Zinc finger protein ZIC 5 (Zinc finger protein of the| cerebellum 5) Length = 639 Score = 25.8 bits (55), Expect(2) = 1.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 371 PPPPKPSFLAKFCPCLAGGGATS 439 PPPP P L+ + +GGG +S Sbjct: 143 PPPPPPPALSGYTTTNSGGGGSS 165 Score = 23.9 bits (50), Expect(2) = 1.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 323 GDYFVGRPSNHEQNTTPPPPKP 388 G Y G S+ Q + PPPP P Sbjct: 110 GSYPCGGGSSGAQPSAPPPPAP 131
>ICAM5_HUMAN (Q9UMF0) Intercellular adhesion molecule 5 precursor (ICAM-5)| (Telencephalin) Length = 924 Score = 30.4 bits (67), Expect = 2.0 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 224 LQEEHCPVRRSWRMGGSPAAISCASSLRPVP 132 + E CP ++W G +A++CA+ RP P Sbjct: 668 MDESTCPSHQTWLEGAEASALACAARGRPSP 698
>RLUB_XANCP (Q8P8M6) Ribosomal large subunit pseudouridine synthase B (EC| 5.4.99.-) (rRNA-uridine isomerase B) (rRNA pseudouridylate synthase B) Length = 492 Score = 30.4 bits (67), Expect = 2.0 Identities = 23/54 (42%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = +2 Query: 98 GRRLVSPERIGTGQG-GERKHS*SQPENRPSAMSDGQGNAPPG--GYFIGRPAN 250 GR + GQG G+RKH P N PS SD +A PG Y RPAN Sbjct: 432 GRGAAGGQGQSQGQGQGQRKHPYGHPGNAPSFPSD---HANPGFSPYGAARPAN 482
>Y4QC_RHISN (P55624) Hypothetical 63.6 kDa protein y4qC| Length = 583 Score = 29.6 bits (65), Expect = 3.5 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = -1 Query: 217 RSIALSVAHGGWAVLRLRSAVLPLSALS---RAYPLRRDETTTSPT 89 R+ LSV G ++L R A LP + S RA+P RRD+ + PT Sbjct: 188 RAAILSVRAGDGSLLGERVAPLPAAVSSTAIRAFPWRRDDQLSLPT 233
>CRLS1_RAT (Q5U2V5) Cardiolipin synthetase (EC 2.7.8.-) (Cardiolipin synthase)| (CLS) Length = 302 Score = 29.3 bits (64), Expect = 4.5 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 7/64 (10%) Frame = +1 Query: 205 GQCSSWRLLHRPSGKHRRAQGERTAAGPP*ACS-GCEQSSW*L------LRRPPVKPRAE 363 G S R+ RP G G R A PP AC GC W L LR P PR Sbjct: 9 GAWGSLRVAVRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRLPGTSPRTH 68 Query: 364 HDAA 375 A Sbjct: 69 CSGA 72
>ICAM5_MOUSE (Q60625) Intercellular adhesion molecule 5 precursor (ICAM-5)| (Telencephalin) Length = 917 Score = 29.3 bits (64), Expect = 4.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 224 LQEEHCPVRRSWRMGGSPAAISCASSLRPVP 132 + E CP ++W G A++C++ RP P Sbjct: 667 MDESSCPSHQTWLEGAEATALACSARGRPSP 697
>P85B_RAT (Q63788) Phosphatidylinositol 3-kinase regulatory beta subunit| (PI3-kinase p85-beta subunit) (PtdIns-3-kinase p85-beta) Length = 722 Score = 28.9 bits (63), Expect = 5.9 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +2 Query: 356 EQNTTPP--PPKPSFLAKFCPCLAGGGAT 436 EQ+T PP PPKPS + LA GG+T Sbjct: 288 EQDTAPPALPPKPSKVKPAPTALANGGST 316
>PCD15_HUMAN (Q96QU1) Protocadherin-15 precursor| Length = 1955 Score = 28.9 bits (63), Expect = 5.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 371 PPPPKPSFLAKFCPCLAGGGATS 439 PPPP SFL+ C C+ G T+ Sbjct: 1828 PPPPSASFLSTECVCITGVKCTT 1850
>VP14_EBV (P03179) Probable membrane antigen P140 (Tegument protein)| Length = 1318 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 230 SSLQEEHCP-VRRSWRMGGSPAAISCASSLRPVPCLSSPAR 111 S L CP SW A+ S+L P PC+S AR Sbjct: 404 SGLTAPPCPYAESSWAQAAVQTALELFSALYPAPCISGYAR 444
>UL47_HHV11 (P10231) Virion protein UL47 (82/81 kDa tegument protein)| (VMW82/81) (VP13/14) Length = 693 Score = 28.5 bits (62), Expect = 7.7 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 148 EEAQLIAAGEPPIRHERRTGQCSSWRLLHRPSGKHRRAQGER 273 E + +A EPP+R R + R P HRRA +R Sbjct: 50 EALEEMAGDEPPVRRRREGPRARRRRASEAPPTSHRRASRQR 91
>UL47_HHV1F (P08313) Virion protein UL47 (82/81 kDa tegument protein)| (VMW82/81) (VP13/14) Length = 664 Score = 28.5 bits (62), Expect = 7.7 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 148 EEAQLIAAGEPPIRHERRTGQCSSWRLLHRPSGKHRRAQGER 273 E + +A EPP+R R + R P HRRA +R Sbjct: 50 EALEEMAGDEPPVRRRREGPRARRRRASEAPPTSHRRASRQR 91
>GBX2_CHICK (O42230) Homeobox protein GBX-2 (Gastrulation and brain-specific| homeobox protein 2) Length = 340 Score = 28.5 bits (62), Expect = 7.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 371 PPPPKPSFLAKFCPCLAGGGA 433 PPPP P+ FCP LA G A Sbjct: 75 PPPPLPALPGAFCPGLAQGMA 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,810,081 Number of Sequences: 219361 Number of extensions: 1374590 Number of successful extensions: 4255 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4238 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)