| Clone Name | baet119f05 |
|---|---|
| Clone Library Name | barley_pub |
>CYSP_SCHMA (P25792) Cathepsin B-like cysteine proteinase precursor (EC| 3.4.22.-) (Antigen Sm31) Length = 340 Score = 61.2 bits (147), Expect = 1e-09 Identities = 32/91 (35%), Positives = 46/91 (50%), Gaps = 6/91 (6%) Frame = +3 Query: 198 IIQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSE----- 362 II +N HPNAGW A + ++++ + +G + P L R K P + Sbjct: 33 IISYINEHPNAGWRAEKSNRF--HSLDDARIQMGARREEPDL----RRKRRPTVDHNDWN 86 Query: 363 -QLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 ++P FD+R KW GC +I I DQ CGSC Sbjct: 87 VEIPSNFDSRKKWPGCKSIATIRDQSRCGSC 117
>CATB_MOUSE (P10605) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 57.8 bits (138), Expect = 1e-08 Identities = 35/82 (42%), Positives = 39/82 (47%), Gaps = 3/82 (3%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHMLGVK---PTPPGLLAGVRTKTHPRSEQLPXEFDA 386 N N W AG N Y N I K + G P PG +A LP FDA Sbjct: 35 NKQNTTWQAGRNFY--NVDISYLKKLCGTVLGGPKLPGRVA------FGEDIDLPETFDA 86 Query: 387 RSKWSGCSTIGKILDQGHCGSC 452 R +WS C TIG+I DQG CGSC Sbjct: 87 REQWSNCPTIGQIRDQGSCGSC 108
>CYSP_SCHJA (P43157) Cathepsin B-like cysteine proteinase precursor (EC| 3.4.22.-) (Antigen Sj31) Length = 342 Score = 56.6 bits (135), Expect = 3e-08 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 2/87 (2%) Frame = +3 Query: 198 IIQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKT--HPRSEQLP 371 +I +N HP+AGW A + ++++ + ++G + + R H + ++P Sbjct: 34 MISFINEHPDAGWKADKSDRF--HSLDDARILMGARKEDAEMKRNRRPTVDHHDLNVEIP 91 Query: 372 XEFDARSKWSGCSTIGKILDQGHCGSC 452 +FD+R KW C +I +I DQ CGSC Sbjct: 92 SQFDSRKKWPHCKSISQIRDQSRCGSC 118
>CATB_RAT (P00787) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) (RSG-2)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 55.5 bits (132), Expect = 6e-08 Identities = 33/79 (41%), Positives = 36/79 (45%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPXEFDARSK 395 N N W AG N Y N I K + G P L V LP FDAR + Sbjct: 35 NKQNTTWQAGRNFY--NVDISYLKKLCGTVLGGPNLPERVGFS---EDINLPESFDAREQ 89 Query: 396 WSGCSTIGKILDQGHCGSC 452 WS C TI +I DQG CGSC Sbjct: 90 WSNCPTIAQIRDQGSCGSC 108
>CATB_HUMAN (P07858) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) (APP| secretase) (APPS) [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 54.7 bits (130), Expect = 1e-07 Identities = 32/82 (39%), Positives = 38/82 (46%), Gaps = 3/82 (3%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHMLGV---KPTPPGLLAGVRTKTHPRSEQLPXEFDA 386 N N W AGHN Y N + K + G P PP + +LP FDA Sbjct: 35 NKRNTTWQAGHNFY--NVDMSYLKRLCGTFLGGPKPP------QRVMFTEDLKLPASFDA 86 Query: 387 RSKWSGCSTIGKILDQGHCGSC 452 R +W C TI +I DQG CGSC Sbjct: 87 REQWPQCPTIKEIRDQGSCGSC 108
>CATB_BOVIN (P07688) Cathepsin B precursor (EC 3.4.22.1) [Contains: Cathepsin B| light chain; Cathepsin B heavy chain] Length = 335 Score = 53.1 bits (126), Expect = 3e-07 Identities = 31/79 (39%), Positives = 36/79 (45%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPXEFDARSK 395 N N W AGHN Y N + K + G P L + LP FDAR + Sbjct: 35 NKQNTTWKAGHNFY--NVDLSYVKKLCGAILGGPKL---PQRDAFAADVVLPESFDAREQ 89 Query: 396 WSGCSTIGKILDQGHCGSC 452 W C TI +I DQG CGSC Sbjct: 90 WPNCPTIKEIRDQGSCGSC 108
>CATB_CHICK (P43233) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 340 Score = 43.5 bits (101), Expect = 2e-04 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = +3 Query: 366 LPXEFDARSKWSGCSTIGKILDQGHCGSC 452 LP FD R +W C TI +I DQG CGSC Sbjct: 80 LPDTFDTRKQWPNCPTISEIRDQGSCGSC 108
>CPR5_CAEEL (P43509) Cathepsin B-like cysteine proteinase 5 precursor (EC| 3.4.22.-) (Cysteine protease-related 5) Length = 344 Score = 42.7 bits (99), Expect = 4e-04 Identities = 22/73 (30%), Positives = 31/73 (42%) Frame = +3 Query: 234 WTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPXEFDARSKWSGCST 413 WTAGH ++ + + P + S+ +P FDAR +W C + Sbjct: 43 WTAGHQVIPKEKITKKLMDVKYLVPHKDEDIVATEV-----SDAIPDHFDARDQWPNCMS 97 Query: 414 IGKILDQGHCGSC 452 I I DQ CGSC Sbjct: 98 INNIRDQSDCGSC 110
>CPR4_CAEEL (P43508) Cathepsin B-like cysteine proteinase 4 precursor (EC| 3.4.22.-) (Cysteine protease-related 4) Length = 335 Score = 42.4 bits (98), Expect = 6e-04 Identities = 25/65 (38%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = +3 Query: 270 TIEQFKHMLG----VKPTPPGLLAGVRTKTHPRSEQLPXEFDARSKWSGCSTIGKILDQG 437 TIEQ K L V P P + K + +P FDAR++W C +I I DQ Sbjct: 48 TIEQVKKRLMRTEFVAPHTPDVEV---VKHDINEDTIPATFDARTQWPNCMSINNIRDQS 104 Query: 438 HCGSC 452 CGSC Sbjct: 105 DCGSC 109
>CPR3_CAEEL (P43507) Cathepsin B-like cysteine proteinase 3 precursor (EC| 3.4.22.-) (Cysteine protease-related 3) Length = 370 Score = 42.4 bits (98), Expect = 6e-04 Identities = 32/92 (34%), Positives = 44/92 (47%), Gaps = 4/92 (4%) Frame = +3 Query: 189 QKGIIQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSE-- 362 QK ++ VN W A HN ++ + ++ FK M P + V ++ R E Sbjct: 32 QKVLVDHVNT-VQTSWVAEHNE-ISEFEMK-FKVMDVKFAEPLEKDSDVASELFVRGEIV 88 Query: 363 --QLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 LP FDAR KW C+TI I +Q CGSC Sbjct: 89 PEPLPDTFDAREKWPDCNTIKLIRNQATCGSC 120
>CATB1_GIALA (P92131) Cathepsin B-like CP1 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B1) Length = 303 Score = 38.9 bits (89), Expect = 0.006 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 9/85 (10%) Frame = +3 Query: 225 NAGWTAGHNPYLANYTIEQFKHMLGVKPT---------PPGLLAGVRTKTHPRSEQLPXE 377 N W AG N T ++F+ ML ++P PP + V+ P +P + Sbjct: 28 NPPWKAGMPKRFENVTEDEFRSML-IRPDRLRARSGSLPPISITEVQELVDP----IPPQ 82 Query: 378 FDARSKWSGCSTIGKILDQGHCGSC 452 FD R ++ C + LDQG CGSC Sbjct: 83 FDFRDEYPQC--VKPALDQGSCGSC 105
>CPR1_CAEEL (P25807) Gut-specific cysteine proteinase precursor (EC 3.4.22.-)| Length = 329 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 366 LPXEFDARSKWSGCSTIGKILDQGHCGSC 452 +P FD+R++WS C +I I DQ CGSC Sbjct: 85 VPATFDSRTQWSECKSIKLIRDQATCGSC 113
>CPR6_CAEEL (P43510) Cathepsin B-like cysteine proteinase 6 precursor (EC| 3.4.22.-) (Cysteine protease-related 6) Length = 379 Score = 38.5 bits (88), Expect = 0.008 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 339 TKTHPRSEQLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 +KT +P FD+R W C +I I DQ CGSC Sbjct: 96 SKTKDLDLDIPESFDSRDNWPKCDSIKVIRDQSSCGSC 133
>CYSP1_OSTOS (P25802) Cathepsin B-like cysteine proteinase 1 precursor (EC| 3.4.22.-) Length = 341 Score = 38.5 bits (88), Expect = 0.008 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +3 Query: 357 SEQLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 ++ +P +D R +W+ CS++ I DQ +CGSC Sbjct: 88 NDDIPESYDPRIQWANCSSLFHIPDQANCGSC 119
>TINAG_HUMAN (Q9UJW2) Tubulointerstitial nephritis antigen (TIN-Ag)| Length = 476 Score = 38.1 bits (87), Expect = 0.010 Identities = 32/91 (35%), Positives = 45/91 (49%), Gaps = 2/91 (2%) Frame = +3 Query: 183 IIQKGIIQTVNNHPNAGWTAGHNPYLANYTIEQ-FKHMLGVKPTPPGLLA-GVRTKTHPR 356 +++ +I+ VN + GWTA + T+E FK LG P P LL+ T + P Sbjct: 155 LVRPELIEQVNKG-DYGWTAQNYSQFWGMTLEDGFKFRLGTLPPSPMLLSMNEMTASLPA 213 Query: 357 SEQLPXEFDARSKWSGCSTIGKILDQGHCGS 449 + LP F A KW G T G LDQ +C + Sbjct: 214 TTDLPEFFVASYKWPGW-THGP-LDQKNCAA 242
>TINAL_RAT (Q9EQT5) Tubulointerstitial nephritis antigen-like precursor| (Glucocorticoid-inducible protein 5) Length = 467 Score = 35.8 bits (81), Expect = 0.052 Identities = 24/89 (26%), Positives = 45/89 (50%), Gaps = 2/89 (2%) Frame = +3 Query: 183 IIQKGIIQTVNNHPNAGWTAGHNPYLANYTIEQ-FKHMLG-VKPTPPGLLAGVRTKTHPR 356 ++ +I+ +N N GW AG++ T+++ ++ LG ++P+ + + Sbjct: 140 LVDPAMIKAINRG-NYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMNEIYTVLGQ 198 Query: 357 SEQLPXEFDARSKWSGCSTIGKILDQGHC 443 E LP F+A KW + I + LDQG+C Sbjct: 199 GEVLPTAFEASEKWP--NLIHEPLDQGNC 225
>TINAL_MOUSE (Q99JR5) Tubulointerstitial nephritis antigen-like precursor| (Androgen-regulated gene 1 protein) (Adrenocortical zonation factor 1) (AZ-1) (Tubulointersititial nephritis antigen-related protein) (TARP) Length = 466 Score = 35.4 bits (80), Expect = 0.067 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 2/78 (2%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQ-FKHMLG-VKPTPPGLLAGVRTKTHPRSEQLPXEFDAR 389 N N GW AG++ T+++ ++ LG ++P+ + + E LP F+A Sbjct: 150 NRGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSTVMNMNEIYTVLGQGEVLPTAFEAS 209 Query: 390 SKWSGCSTIGKILDQGHC 443 KW + I + LDQG+C Sbjct: 210 EKWP--NLIHEPLDQGNC 225
>ORYB_ORYSA (P25777) Oryzain beta chain precursor (EC 3.4.22.-)| Length = 471 Score = 35.0 bits (79), Expect = 0.088 Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Frame = +3 Query: 231 GWTAGHNPYLANYTIEQFKH-MLGVKPTPPGLLAGVRTKTHPRSEQLPXEFDARSKWSGC 407 G+ G N + A+ T E+F+ LG K AG R + H E+LP D R K Sbjct: 96 GFRLGMNRF-ADLTNEEFRATFLGAKVAERSRAAGERYR-HDGVEELPESVDWREK---- 149 Query: 408 STIGKILDQGHCGSC 452 + + +QG CGSC Sbjct: 150 GAVAPVKNQGQCGSC 164
>CATC_SCHMA (Q26563) Cathepsin C precursor (EC 3.4.22.-)| Length = 454 Score = 35.0 bits (79), Expect = 0.088 Identities = 32/99 (32%), Positives = 44/99 (44%), Gaps = 10/99 (10%) Frame = +3 Query: 186 IQKGIIQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLG-VKP--TPPGLLAGVRTKTHPR 356 I + +N H + W P L+ YTI++ ++ G VK T P +L + P Sbjct: 154 INPSFVGKINAHQKS-WRGEIYPELSKYTIDELRNRAGGVKSMVTRPSVL----NRKTPS 208 Query: 357 SE------QLPXEFDARSKWSGC-STIGKILDQGHCGSC 452 E LP EFD S G S + I +QG CGSC Sbjct: 209 KELISLTGNLPLEFDWTSPPDGSRSPVTPIRNQGICGSC 247
>CATB_COTJA (P81494) Cathepsin B (EC 3.4.22.1) (Cathepsin B1) (Fragments)| Length = 48 Score = 33.5 bits (75), Expect = 0.26 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 366 LPXEFDARSKWSGCSTIGKILDQG 437 LP FD+R +W C TI +I DQG Sbjct: 1 LPDTFDSRKQWPNCPTISEIRDQG 24
>CATB2_GIALA (P92132) Cathepsin B-like CP2 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B2) Length = 300 Score = 32.7 bits (73), Expect = 0.44 Identities = 20/76 (26%), Positives = 30/76 (39%) Frame = +3 Query: 225 NAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPXEFDARSKWSG 404 N W AG T ++ +L T + +P FD R ++ Sbjct: 28 NPRWKAGIPKRFEGLTKDEISSLLMPVSFLKNAKGAAPRGTFTDKDDVPESFDFREEYPH 87 Query: 405 CSTIGKILDQGHCGSC 452 C I +++DQG CGSC Sbjct: 88 C--IPEVVDQGGCGSC 101
>CPR2_ARATH (Q9LXW3) Probable cysteine proteinase At3g43960 precursor (EC| 3.4.22.-) Length = 376 Score = 32.3 bits (72), Expect = 0.57 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 1/85 (1%) Frame = +3 Query: 201 IQTVNNHPNAGWTAGHNPYLANYTIEQFK-HMLGVKPTPPGLLAGVRTKTHPRSEQLPXE 377 I+ N+ PN + G N + ++ T ++F+ LG K L + + LP E Sbjct: 72 IEEHNSDPNRSYERGLNKF-SDLTADEFQASYLGGKMEKKSLSDVAERYQYKEGDVLPDE 130 Query: 378 FDARSKWSGCSTIGKILDQGHCGSC 452 D R + + + ++ QG CGSC Sbjct: 131 VDWRERGA---VVPRVKRQGECGSC 152
>CATL_BRUPA (O17473) Cathepsin L-like precursor (EC 3.4.22.15)| Length = 395 Score = 32.0 bits (71), Expect = 0.74 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 4/69 (5%) Frame = +3 Query: 258 LANYTIEQFKHMLGVKPTPPGLLAGVRTKT----HPRSEQLPXEFDARSKWSGCSTIGKI 425 LA+ T E+F G++ L G R + + +SE+LP + D R+K + + Sbjct: 142 LADLTDEEFMVRNGLRLPNQTDLRGKRQTSEFYRYDKSERLPDQVDWRTK----GAVTPV 197 Query: 426 LDQGHCGSC 452 +QG CGSC Sbjct: 198 RNQGECGSC 206
>CATB3_GIALA (P92133) Cathepsin B-like CP3 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B3) Length = 299 Score = 32.0 bits (71), Expect = 0.74 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 363 QLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 Q P FD R ++ C I +++DQG CGSC Sbjct: 73 QAPDSFDFREEYPHC--IPEVVDQGGCGSC 100
>CYSP1_MAIZE (Q10716) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 371 Score = 30.4 bits (67), Expect = 2.2 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Frame = +3 Query: 294 LGVKPTPPGLLAGVRTKTHPR----SEQLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 LG++ + LL + H ++ LP +FD W +G + +QG CGSC Sbjct: 109 LGLRKSRRALLRELGESAHEAPVLPTDGLPDDFD----WRDHGAVGPVKNQGSCGSC 161
>CYSP_PEA (P25804) Cysteine proteinase 15A precursor (EC 3.4.22.-)| (Turgor-responsive protein 15A) Length = 363 Score = 30.0 bits (66), Expect = 2.8 Identities = 26/101 (25%), Positives = 41/101 (40%), Gaps = 7/101 (6%) Frame = +3 Query: 171 HSLGIIQKGIIQTVNNHPNAGWTAGHN-PYLANYTIEQFKHMLGVKPTPPGLLAGVRTKT 347 + G+ + +I+ H N TA H ++ T +F+ GL +R Sbjct: 67 YRFGVFKSNLIKA-KLHQNRDPTAEHGITKFSDLTASEFRRQF------LGLKKRLRLPA 119 Query: 348 HPR------SEQLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 H + + LP +FD R K + + DQG CGSC Sbjct: 120 HAQKAPILPTTNLPEDFDWREK----GAVTPVKDQGSCGSC 156
>CPR3_ARATH (Q9SUT0) Probable cysteine proteinase At4g11310 precursor (EC| 3.4.22.-) Length = 364 Score = 29.6 bits (65), Expect = 3.7 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 5/69 (7%) Frame = +3 Query: 261 ANYTIEQFKHML-GVKPTPPG----LLAGVRTKTHPRSEQLPXEFDARSKWSGCSTIGKI 425 A+ ++ ++K + G P PP + + R KT + LP D W + ++ Sbjct: 98 ADLSLHEYKEVCHGADPRPPRNHVFMTSSDRYKTSA-DDVLPKSVD----WRNEGAVTEV 152 Query: 426 LDQGHCGSC 452 DQGHC SC Sbjct: 153 KDQGHCRSC 161
>CYSP1_ORYSA (Q7XR52) Cysteine protease 1 precursor (EC 3.4.22.-) (OsCP1)| Length = 490 Score = 29.6 bits (65), Expect = 3.7 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +3 Query: 231 GWTAGHNPYLANYTIEQFKHM-LGVKPTPPGLLAGVRTKTHPRSEQLPXEFDARSKWSGC 407 G+ G N + A+ T +F+ LG P G G + H E LP D R K + Sbjct: 111 GFRLGMNRF-ADLTNGEFRATYLGTTPAGRGRRVGEAYR-HDGVEALPDSVDWRDKGA-- 166 Query: 408 STIGKILDQGHCGSC 452 + + +QG CGSC Sbjct: 167 -VVAPVKNQGQCGSC 180
>CPR1_DROME (Q9VN93) Putative cysteine proteinase CG12163 precursor (EC| 3.4.22.-) Length = 614 Score = 29.6 bits (65), Expect = 3.7 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Frame = +3 Query: 261 ANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSE-QLPXEFDARSKWSGCSTIGKILDQG 437 A+ T ++K G+ G P +LP EFD R K + ++ +QG Sbjct: 358 ADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQK----DAVTQVKNQG 413 Query: 438 HCGSC 452 CGSC Sbjct: 414 SCGSC 418
>CATV_NPVSE (Q9J8B9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 29.3 bits (64), Expect = 4.8 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 351 PRSEQLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 P Q P FD W + I + DQG CG+C Sbjct: 121 PAQRQRPVSFD----WRSMNKITSVKDQGMCGAC 150
>CATL_DROME (Q95029) Cathepsin L precursor (EC 3.4.22.15) (Cysteine proteinase| 1) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 341 Score = 29.3 bits (64), Expect = 4.8 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 351 PRSEQLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 P LP D R+K + + DQGHCGSC Sbjct: 119 PAHVTLPKSVDWRTK----GAVTAVKDQGHCGSC 148
>CATF_HUMAN (Q9UBX1) Cathepsin F precursor (EC 3.4.22.41) (CATSF)| Length = 484 Score = 28.9 bits (63), Expect = 6.3 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 369 PXEFDARSKWSGCSTIGKILDQGHCGSC 452 P E+D RSK + K+ DQG CGSC Sbjct: 272 PPEWDWRSK----GAVTKVKDQGMCGSC 295
>XCP1_ARATH (O65493) Xylem cysteine proteinase 1 precursor (EC 3.4.22.-)| (AtXCP1) Length = 355 Score = 28.5 bits (62), Expect = 8.2 Identities = 25/88 (28%), Positives = 32/88 (36%), Gaps = 8/88 (9%) Frame = +3 Query: 213 NNHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPXEFDARS 392 NN N+ W G N + A+ T E+FK G G+ R Q F R Sbjct: 86 NNEINSYWL-GLNEF-ADLTHEEFK----------GRYLGLAKPQFSRKRQPSANFRYRD 133 Query: 393 --------KWSGCSTIGKILDQGHCGSC 452 W + + DQG CGSC Sbjct: 134 ITDLPKSVDWRKKGAVAPVKDQGQCGSC 161
>CATV_NPVMC (Q8QLK1) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 28.5 bits (62), Expect = 8.2 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 351 PRSEQLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 P Q P FD W + + + DQG CG+C Sbjct: 121 PGQRQRPANFD----WRNYNKVTSVKDQGMCGAC 150
>ORYA_ORYSA (P25776) Oryzain alpha chain precursor (EC 3.4.22.-)| Length = 458 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 357 SEQLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 +E LP D R+K + +I DQG CGSC Sbjct: 126 NEALPESVDWRTK----GAVAEIKDQGGCGSC 153
>CYSP4_BRANA (P25251) Cysteine proteinase COT44 precursor (EC 3.4.22.-)| (Fragment) Length = 328 Score = 28.5 bits (62), Expect = 8.2 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 6/85 (7%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHM-LGVKPTPPGLLAGVRTKTHPRS-----EQLPXE 377 N+ NA + G + AN T ++++ + LG + P + + S +++P Sbjct: 45 NNKNATYKLGLTIF-ANLTNDEYRSLYLGARTEPVRRITKAKNVNMKYSAAVNVDEVPVT 103 Query: 378 FDARSKWSGCSTIGKILDQGHCGSC 452 D R K + I DQG CGSC Sbjct: 104 VDWRQK----GAVNAIKDQGTCGSC 124
>CATLL_FASHE (Q24940) Cathepsin L-like proteinase precursor (EC 3.4.22.-)| Length = 326 Score = 28.5 bits (62), Expect = 8.2 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 7/101 (6%) Frame = +3 Query: 171 HSLGIIQKGI--IQTVNNHPNAG---WTAGHNPYLANYTIEQFK--HMLGVKPTPPGLLA 329 H I +K + IQ N + G +T G N + + T E+FK ++ + L Sbjct: 39 HRRNIWEKNVKHIQEHNLRHDLGLVTYTLGLNQF-TDMTFEEFKAKYLTEMSRASDILSH 97 Query: 330 GVRTKTHPRSEQLPXEFDARSKWSGCSTIGKILDQGHCGSC 452 GV + + R+ +P + D W + ++ DQG+CGSC Sbjct: 98 GVPYEANNRA--VPDKID----WRESGYVTEVKDQGNCGSC 132 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,159,137 Number of Sequences: 219361 Number of extensions: 1019278 Number of successful extensions: 3281 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 3189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3274 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)