| Clone Name | baet119c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EVPL_MOUSE (Q9D952) Envoplakin (p210) (210 kDa cornified envelop... | 29 | 4.6 | 2 | HDAC4_CHICK (P83038) Histone deacetylase 4 (HD4) | 29 | 4.6 | 3 | PARC_MOUSE (Q80TT8) p53-associated parkin-like cytoplasmic protein | 29 | 6.0 | 4 | RNC_CAEEL (O01326) Ribonuclease III (EC 3.1.26.3) (RNase III) | 29 | 6.0 | 5 | RPC1_TRYBB (P08968) DNA-directed RNA polymerase III largest subu... | 28 | 7.9 |
|---|
>EVPL_MOUSE (Q9D952) Envoplakin (p210) (210 kDa cornified envelope precursor| protein) Length = 2035 Score = 29.3 bits (64), Expect = 4.6 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -1 Query: 439 EDVAVLHPAHHRRGRRQLGGARHAHAGQTEVLRVGQQDEDGQRREVDRHRPEQ 281 ED+ +H A R+ G HA ++EVL+ ++E + EV R EQ Sbjct: 892 EDIQAIHSA-----RQGSGSPAHARTAESEVLKTQLEEERKRVAEVQRDLEEQ 939
>HDAC4_CHICK (P83038) Histone deacetylase 4 (HD4)| Length = 1080 Score = 29.3 bits (64), Expect = 4.6 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -1 Query: 409 HRRGRRQLGGARHAHAGQTEVLRVGQQDEDGQ-RREVDRHRPEQDLHQE 266 H + RQ H H Q E+L + Q E + +R++++HR EQ+L ++ Sbjct: 97 HEQLSRQHEAQLHEHIKQQEMLAMKHQQELLEHQRKLEQHRQEQELEKQ 145
>PARC_MOUSE (Q80TT8) p53-associated parkin-like cytoplasmic protein| Length = 1865 Score = 28.9 bits (63), Expect = 6.0 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = -2 Query: 447 SPRKMSQYFIPLTTGADDASLVARGTLTPVRPKYCALVSRMRMASAEK*TGTGPNRTFT 271 S R ++Q ++ + G L A + P+YC+L R++ A +E GP FT Sbjct: 807 SLRNLTQCWLSVVQGQVSRFLAAAWRASDFVPRYCSLYQRLQSAGSEL---FGPRAAFT 862
>RNC_CAEEL (O01326) Ribonuclease III (EC 3.1.26.3) (RNase III)| Length = 1086 Score = 28.9 bits (63), Expect = 6.0 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 3/66 (4%) Frame = -1 Query: 448 LAAEDVAVLHPAHHRRGR---RQLGGARHAHAGQTEVLRVGQQDEDGQRREVDRHRPEQD 278 L A+ ++HP H +GR +Q GG A QDE +R PE D Sbjct: 147 LQADVPYIIHPCHSMKGRKTPKQKGGDESFTASDVSDDSNDSQDEASTSEPTNRQAPEAD 206 Query: 277 LHQEME 260 E++ Sbjct: 207 KTGEVK 212
>RPC1_TRYBB (P08968) DNA-directed RNA polymerase III largest subunit (EC| 2.7.7.6) Length = 1530 Score = 28.5 bits (62), Expect = 7.9 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -1 Query: 415 AHHRRGRRQLGGARHAHAGQTEVLRVGQQDEDGQRREVDRHR 290 A+H RR + H H G T V + + + E DRHR Sbjct: 402 ANHELMRRLVRNGPHVHPGATTVYLAQEGSKKSLKNERDRHR 443 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,419,674 Number of Sequences: 219361 Number of extensions: 782607 Number of successful extensions: 2813 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2812 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)