| Clone Name | baet119c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1477_PYRKO (Q5JJC3) UPF0103 protein TK1477 | 29 | 4.2 | 2 | CR054_MOUSE (Q8CB14) Protein C18orf54 homolog precursor | 29 | 5.5 | 3 | Y1638_PYRFU (Q8U0F2) UPF0103 protein PF1638 | 29 | 5.5 | 4 | ATPD_TOBAC (P32980) ATP synthase delta chain, chloroplast precur... | 28 | 7.2 | 5 | NUP88_MOUSE (Q8CEC0) Nuclear pore complex protein Nup88 (Nucleop... | 28 | 7.2 |
|---|
>Y1477_PYRKO (Q5JJC3) UPF0103 protein TK1477| Length = 291 Score = 29.3 bits (64), Expect = 4.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 218 SKLPGAVAEALVHYATSNVTPQQTAAEIGVSLRVLQR 328 S+L GAV L+HY TS + T A +G + V +R Sbjct: 255 SRLAGAVEAELLHYTTSFEVSRSTEAVVGYASIVFRR 291
>CR054_MOUSE (Q8CB14) Protein C18orf54 homolog precursor| Length = 526 Score = 28.9 bits (63), Expect = 5.5 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -1 Query: 426 SSSRNTVRPPWLSAAHMGLSCPRPNTRK-LHGERRCSTRS 310 S S+N + PP++ G C RP T K ++ E +C + S Sbjct: 176 SKSKNNIVPPYVYTNINGKKCGRPRTPKPINRENKCVSES 215
>Y1638_PYRFU (Q8U0F2) UPF0103 protein PF1638| Length = 292 Score = 28.9 bits (63), Expect = 5.5 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 218 SKLPGAVAEALVHYATSNVTPQQTAAEIGVSLRVLQR 328 SKL GA+ L+HY TS + T A +G + V+++ Sbjct: 255 SKLAGAIEAELLHYTTSFEVSRSTDAIVGYASIVMRK 291
>ATPD_TOBAC (P32980) ATP synthase delta chain, chloroplast precursor (EC| 3.6.3.14) Length = 248 Score = 28.5 bits (62), Expect = 7.2 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +2 Query: 188 GGEGDGDGSCSKLPGAVAEALVHYATSNVTPQQTAAEIGVSLRVLQRRSPCNFLV 352 GG G + G+ A AL A SN T +QT A++ ++ + NF V Sbjct: 53 GGGAAGSKMVASAAGSYANALADIAKSNGTLEQTTADLEKIEKISDDEAVFNFFV 107
>NUP88_MOUSE (Q8CEC0) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) Length = 753 Score = 28.5 bits (62), Expect = 7.2 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 3/70 (4%) Frame = +2 Query: 188 GGEGDGDGSCSKLPGAVAEALVHYATSNVTP---QQTAAEIGVSLRVLQRRSPCNFLVFG 358 G GDG+ S LP V + N +P ++ AA S L P LVFG Sbjct: 6 GPLGDGELWQSWLPNHVVFLRLREGVRNQSPAEAEKPAASTSPSCPSLPPHLPTRNLVFG 65 Query: 359 LGHDSPMWAA 388 LG + +W A Sbjct: 66 LGGELFLWDA 75 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,781,956 Number of Sequences: 219361 Number of extensions: 419981 Number of successful extensions: 1530 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1530 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)