| Clone Name | baet117g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IPP4_HUMAN (O14990) Type-1 protein phosphatase inhibitor 4 (I-4)... | 28 | 6.6 |
|---|
>IPP4_HUMAN (O14990) Type-1 protein phosphatase inhibitor 4 (I-4) (Protein| phosphatase 1, regulatory subunit 2 pseudogene 9) Length = 202 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = -1 Query: 151 NYSPNAKCALEFLWAELKSQGHEQIDFARGKNPRNLLPSTHTHRPIT 11 N N K A + +W EL+S+ +E + +G N P+T Sbjct: 146 NEELNIKLARQLMWKELQSEDNENEETPQGTNEEKTAAEESEEAPLT 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,165,801 Number of Sequences: 219361 Number of extensions: 384231 Number of successful extensions: 922 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 922 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)