| Clone Name | baet117c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PODXL_RABIT (Q28645) Podocalyxin-like protein 1 precursor | 29 | 8.7 |
|---|
>PODXL_RABIT (Q28645) Podocalyxin-like protein 1 precursor| Length = 551 Score = 28.9 bits (63), Expect = 8.7 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +2 Query: 8 SLSHERSFTLAPTPARTSASLCSTMASTPPPVISKAGNL 124 SLS E+S PTP TS S AS P P S A ++ Sbjct: 19 SLSQEKSPQPGPTPMATSTSTRPAPASAPAPKSSVAASV 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,859,095 Number of Sequences: 219361 Number of extensions: 644915 Number of successful extensions: 2684 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2681 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)