| Clone Name | baet116f08 |
|---|---|
| Clone Library Name | barley_pub |
>RIMB1_MOUSE (Q7TNF8) Peripheral-type benzodiazepine receptor-associated protein 1| (PRAX-1) (Peripheral benzodiazepine receptor-interacting protein) (PBR-IP) (RIM-binding protein 1) (RIM-BP1) Length = 1846 Score = 30.8 bits (68), Expect = 1.9 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +3 Query: 315 QALHRPVPPREAGAVQPGVRG-RVGAVDGEQGR 410 QA RPVPPRE G++ P + G RVG G +GR Sbjct: 1429 QASARPVPPRERGSL-PVIEGTRVGQEPGGRGR 1460
>SRCH_RABIT (P16230) Sarcoplasmic reticulum histidine-rich calcium-binding| protein precursor Length = 852 Score = 30.8 bits (68), Expect = 1.9 Identities = 23/66 (34%), Positives = 25/66 (37%), Gaps = 16/66 (24%) Frame = +3 Query: 228 QGHALQH---------HRQG------RRGHAGLRARQQGHRPRRQA-LHRPVPPREAGAV 359 +GHA +H HR G RGH RQQGH P HR E G Sbjct: 590 EGHAEEHQTEVPGHHQHRMGDTDTSAERGHPASSPRQQGHPPEDTVHHHRGSLKEEVGPE 649 Query: 360 QPGVRG 377 PG G Sbjct: 650 SPGPAG 655
>L2MU_ADE02 (P14269) Late L2 mu core protein precursor (pMu) (Protein X) (pX)| (11 kDa core protein) Length = 79 Score = 30.8 bits (68), Expect = 1.9 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +3 Query: 246 HHRQGRRGHAGLRARQQGHRPRRQALHRPVPPREAGAVQPGVRGRVGAVDG 398 H R+G GH ++ H RR+A HR + + P + +GAV G Sbjct: 18 HRRRGMAGHGLTGGMRRAHHRRRRASHRRMRGGILPLLIPLIAAAIGAVPG 68
>AFSK_STRGR (P54742) Serine/threonine protein kinase afsK (EC 2.7.11.1)| Length = 807 Score = 30.0 bits (66), Expect = 3.2 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +3 Query: 42 RSPRRQDVRVRAPPQGPGAG 101 R PR + R+RA PQGPGAG Sbjct: 305 RPPRPRPRRLRAAPQGPGAG 324
>NIKE_PSEPK (Q88HL0) Nickel import ATP-binding protein nikE (EC 3.6.3.24)| Length = 273 Score = 29.3 bits (64), Expect = 5.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 473 P*GRQAEAGVLTMRMQRKPXPTSL 402 P GRQ +A VL +R QR+P P L Sbjct: 245 PVGRQLQAAVLPVRPQRRPSPQGL 268
>PLSX_DEIRA (Q46578) Fatty acid/phospholipid synthesis protein plsX| Length = 360 Score = 29.3 bits (64), Expect = 5.5 Identities = 23/53 (43%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = +3 Query: 240 LQHHRQGRRGHAGLRARQQGHRPRRQ---ALHRPVPPREAG-AVQPGVRGRVG 386 L+ R AGL +Q RPRRQ A RP P AG A GVRG G Sbjct: 298 LRREHLDRGAGAGLYRPRQRRRPRRQKRRAACRPRPRSAAGRAPGSGVRGAAG 350
>ILR1_ARATH (P54968) IAA-amino acid hydrolase ILR1 precursor (EC 3.5.1.-)| Length = 442 Score = 29.3 bits (64), Expect = 5.5 Identities = 23/92 (25%), Positives = 35/92 (38%), Gaps = 1/92 (1%) Frame = +1 Query: 67 GFGHHHKDQAPAASGPNQIFKI-YCRASEDYSLAVRDGEVVLAPVNPKDETQHWLKDMRF 243 G H K A A G N ED+S + + + + K+ET K + Sbjct: 343 GLYEHGKKVAEAMIGKNNFHDFPVTMGGEDFSFFTQKTKAAIFVLGVKNETLGAGKPLHS 402 Query: 244 STTVKDEEGMPAFALVNKATGLAVKHSIGQSH 339 DEE +P A ++ A ++ G SH Sbjct: 403 PYFFVDEEALPVGAALHAAMAVSYLDEHGHSH 434
>YLS6_CAEEL (P34391) Putative cuticle collagen F09G8.6| Length = 278 Score = 28.5 bits (62), Expect = 9.4 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +3 Query: 282 RARQQGHRPRRQALHRPVPPREAGAVQPGVRGRVG--AVDGEQG 407 RAR+Q P QAL + PP G PG G G VDG+ G Sbjct: 71 RARRQAALPDCQALAKNCPPGPPG--PPGAPGAAGEPGVDGDAG 112
>CAC1A_RABIT (P27884) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2424 Score = 28.5 bits (62), Expect = 9.4 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = +3 Query: 231 GHALQHHRQGRRGHAGLRARQQGHRPRRQALHRPVPPREAGAVQPGVRGR 380 G R+ RG R + + HRP H P R G V PGV R Sbjct: 2197 GDLPSREREQERG----RPKDRKHRPHHHHHHHHHPGRGPGRVSPGVSAR 2242
>YGY3_HALSQ (P21561) Hypothetical 50.6 kDa protein in the 5'region of gyrA and| gyrB (ORF 3) Length = 437 Score = 28.5 bits (62), Expect = 9.4 Identities = 21/57 (36%), Positives = 23/57 (40%) Frame = +3 Query: 231 GHALQHHRQGRRGHAGLRARQQGHRPRRQALHRPVPPREAGAVQPGVRGRVGAVDGE 401 GH HH +GRRG R R QG R GA P VR R+ GE Sbjct: 230 GHGDGHHLEGRRG----RPRPQGREAGR------------GAHPPQVRARIYLAAGE 270 Score = 28.5 bits (62), Expect = 9.4 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +3 Query: 243 QHHRQGRRGHAGLRARQQGHRPRRQALHRPVPPREAGAV---QPGVRGR 380 Q H+ R HA R Q G PRRQ L PR AG QP RGR Sbjct: 134 QQHQHPRGRHASDRV-QDGAHPRRQRLRE--QPRHAGRPRRRQPPRRGR 179 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,220,055 Number of Sequences: 219361 Number of extensions: 968951 Number of successful extensions: 3982 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3980 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)