| Clone Name | baet116b06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRG4_HUMAN (Q92954) Proteoglycan-4 precursor (Lubricin) (Megakar... | 32 | 0.66 | 2 | EFP_MYCPA (Q741J3) Elongation factor P (EF-P) | 31 | 1.9 | 3 | EFP_MYCTU (P64034) Elongation factor P (EF-P) | 29 | 5.6 | 4 | EFP_MYCBO (P64035) Elongation factor P (EF-P) | 29 | 5.6 | 5 | EFP_COREF (Q8FT34) Elongation factor P (EF-P) | 28 | 9.6 | 6 | SYV_NEIG1 (Q5F5W0) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 28 | 9.6 | 7 | ZBP2_CHICK (Q8UVD9) Zipcode-binding protein 2 | 28 | 9.6 |
|---|
>PRG4_HUMAN (Q92954) Proteoglycan-4 precursor (Lubricin) (Megakaryocyte| stimulating factor) (Superficial zone proteoglycan) [Contains: Proteoglycan-4 C-terminal part] Length = 1404 Score = 32.3 bits (72), Expect = 0.66 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 190 VQPQPNQLTYHNGAVLHGDIPVSVLWYGRFTAAQKAI 300 +Q P +L Y + VLH ++ VS+LW G AI Sbjct: 1318 IQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAI 1354
>EFP_MYCPA (Q741J3) Elongation factor P (EF-P)| Length = 187 Score = 30.8 bits (68), Expect = 1.9 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +1 Query: 184 FLVQPQPNQLTYHNGAVLHGDIPVSV 261 FL++ P Q+ +HNG+ L+ ++PVSV Sbjct: 104 FLLEGMPVQVAFHNGSPLYIELPVSV 129
>EFP_MYCTU (P64034) Elongation factor P (EF-P)| Length = 187 Score = 29.3 bits (64), Expect = 5.6 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 184 FLVQPQPNQLTYHNGAVLHGDIPVSV 261 FL++ P Q+ +HNG L+ ++PV+V Sbjct: 104 FLLEGMPVQVAFHNGVPLYIELPVTV 129
>EFP_MYCBO (P64035) Elongation factor P (EF-P)| Length = 187 Score = 29.3 bits (64), Expect = 5.6 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 184 FLVQPQPNQLTYHNGAVLHGDIPVSV 261 FL++ P Q+ +HNG L+ ++PV+V Sbjct: 104 FLLEGMPVQVAFHNGVPLYIELPVTV 129
>EFP_COREF (Q8FT34) Elongation factor P (EF-P)| Length = 187 Score = 28.5 bits (62), Expect = 9.6 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 184 FLVQPQPNQLTYHNGAVLHGDIPVSV 261 FL++ Q+++H+G L G++PVSV Sbjct: 104 FLLENMRVQVSFHDGEALFGELPVSV 129
>SYV_NEIG1 (Q5F5W0) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 945 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = -3 Query: 285 RREAAVPEDGDGDVAVQHGAVVVRELVRLGLDQEHELPR 169 R+ AA+PE GD VAV +GA R ++++ +D+ E R Sbjct: 851 RQVAALPESGDAPVAVCNGA---RLMLKVEIDKAAETAR 886
>ZBP2_CHICK (Q8UVD9) Zipcode-binding protein 2| Length = 769 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = +3 Query: 45 NLFPRSKPLFLPSPNGQEKXXXXXGANGARR*HGSRVGYREHEEAHVPGPAPAEP 209 N +P+ +P P+P+ K N A GY H PGP P +P Sbjct: 608 NTYPQWQP---PAPHDPSKAAAAADPNAAW------AGYYSHYYQQPPGPVPGQP 653 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,955,142 Number of Sequences: 219361 Number of extensions: 660825 Number of successful extensions: 2235 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2232 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)