| Clone Name | baet116a01 |
|---|---|
| Clone Library Name | barley_pub |
>UBP3_ARATH (O24454) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) (AtUBP3) Length = 371 Score = 74.7 bits (182), Expect(2) = 5e-16 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 341 MGASGSKLEKALGDQFPEGERYFGLENFGNTCYC 442 MGA+GSKLEKALGDQFPEGERYFG ENFGNTCYC Sbjct: 1 MGAAGSKLEKALGDQFPEGERYFGFENFGNTCYC 34 Score = 28.1 bits (61), Expect(2) = 5e-16 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 442 HSVLQALYFCTPF 480 +SVLQALYFC PF Sbjct: 35 NSVLQALYFCVPF 47
>UBP4_ARATH (Q8LAM0) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (AtUBP4) Length = 365 Score = 74.7 bits (182), Expect(2) = 5e-16 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 341 MGASGSKLEKALGDQFPEGERYFGLENFGNTCYC 442 MGA+GSKLEKALGDQFPEGERYFG ENFGNTCYC Sbjct: 1 MGAAGSKLEKALGDQFPEGERYFGFENFGNTCYC 34 Score = 28.1 bits (61), Expect(2) = 5e-16 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 442 HSVLQALYFCTPF 480 +SVLQALYFC PF Sbjct: 35 NSVLQALYFCAPF 47
>UBP12_HUMAN (O75317) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) (Ubiquitin hydrolyzing enzyme 1) Length = 355 Score = 53.1 bits (126), Expect(2) = 2e-09 Identities = 24/35 (68%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +2 Query: 341 MGASGSKLEKALG-DQFPEGERYFGLENFGNTCYC 442 MGA+ S LEK +G +QFP E YFGL NFGNTCYC Sbjct: 1 MGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYC 35 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 442 HSVLQALYFCTPF 480 +SVLQALYFC PF Sbjct: 36 NSVLQALYFCRPF 48
>UBP46_MOUSE (P62069) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 50.8 bits (120), Expect(2) = 7e-09 Identities = 23/35 (65%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = +2 Query: 341 MGASGSKLEKALG-DQFPEGERYFGLENFGNTCYC 442 MG + S LEK +G +QFP E YFGL NFGNTCYC Sbjct: 12 MGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYC 46 Score = 27.7 bits (60), Expect(2) = 7e-09 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 442 HSVLQALYFCTPF 480 +SVLQALYFC PF Sbjct: 47 NSVLQALYFCRPF 59
>UBP46_HUMAN (P62068) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 50.8 bits (120), Expect(2) = 7e-09 Identities = 23/35 (65%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = +2 Query: 341 MGASGSKLEKALG-DQFPEGERYFGLENFGNTCYC 442 MG + S LEK +G +QFP E YFGL NFGNTCYC Sbjct: 12 MGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYC 46 Score = 27.7 bits (60), Expect(2) = 7e-09 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 442 HSVLQALYFCTPF 480 +SVLQALYFC PF Sbjct: 47 NSVLQALYFCRPF 59
>UBPX_CAEEL (P34547) Probable ubiquitin carboxyl-terminal hydrolase R10E11.3| (EC 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin-specific processing protease) (Deubiquitinating enzyme) Length = 410 Score = 37.7 bits (86), Expect(2) = 2e-04 Identities = 20/38 (52%), Positives = 24/38 (63%), Gaps = 4/38 (10%) Frame = +2 Query: 341 MGASGS-KLEKALGDQFP---EGERYFGLENFGNTCYC 442 MGA+GS +LEK + E Y+GL NFGNTCYC Sbjct: 1 MGATGSSQLEKEISTTESVNNANEHYYGLVNFGNTCYC 38 Score = 25.4 bits (54), Expect(2) = 2e-04 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +1 Query: 442 HSVLQALYFCTPF 480 +SV+QAL+FC PF Sbjct: 39 NSVIQALFFCRPF 51
>UBP13_YEAST (P38187) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) Length = 688 Score = 35.8 bits (81), Expect = 0.060 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = +2 Query: 287 GFRYLTGA-ATGWWDRWMVMGASGSKLEKALGDQFPEGE---RYFGLENFGNTCYC 442 G Y++ A A + + G L + D P G+ + FG ENFGNTCYC Sbjct: 96 GIFYISNAKAINAYGGIITQGPEAPILAMKVSDSMPYGDGSNKVFGYENFGNTCYC 151
>UBP9_YEAST (P39967) Ubiquitin carboxyl-terminal hydrolase 9 (EC 3.1.2.15)| (Ubiquitin thioesterase 9) (Ubiquitin-specific-processing protease 9) (Deubiquitinating enzyme 9) Length = 754 Score = 33.9 bits (76), Expect = 0.23 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +2 Query: 308 AATGWWDRWMVMGASGSKLEKALGDQFPEGE---RYFGLENFGNTCYC 442 ++T + DR S L + D P G+ + FG ENFGNTCYC Sbjct: 100 SSTTYEDR--AFDTESSILFTTITDLMPYGDGSNKVFGYENFGNTCYC 145
>SMR1_MOUSE (Q61900) Submaxillary gland androgen-regulated protein 1 precursor| (Salivary protein MSG1) Length = 147 Score = 33.1 bits (74), Expect = 0.39 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 Query: 53 PKISSHTPPPPCPGAKRHRRRLTHPTPSPPT 145 P I PPPPCP H R ++P+P PPT Sbjct: 68 PGIGRPPPPPPCPPVPPHPRPPSNPSP-PPT 97
>IF2_SYNEL (Q8DK04) Translation initiation factor IF-2| Length = 957 Score = 33.1 bits (74), Expect = 0.39 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPTR 148 P+ PKP+LQ + P + P PP P A + + P+PP + Sbjct: 96 PEAPKPQLQKPPARPQPPQAPTRPTPPAPVAPKPVEPVAAKPPAPPAK 143
>EBNA4_EBV (P03203) Epstein-Barr nuclear antigen 4 (EBV nuclear antigen 4)| (EBNA-4) (EBNA-3B) Length = 938 Score = 32.7 bits (73), Expect = 0.51 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +2 Query: 20 PKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRV 151 P++ + QR + TPPP P R R R PTP+PP +V Sbjct: 707 PEVPPVPRQRPRGAPTPTPPPQVPPVPRQRPR-GAPTPTPPPQV 749
>VASA_DROME (P09052) ATP-dependent RNA helicase vasa (EC 3.6.1.-) (Antigen| Mab46F11) Length = 661 Score = 32.3 bits (72), Expect = 0.66 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = -3 Query: 259 GRRGGQGGSQEPMSDMQAGVESAVTRRGRNEGGDEENARGGRRSWVGE 116 G RGGQGGS+ + G R NE GDE R R GE Sbjct: 106 GSRGGQGGSRGGQGGFRGGEGGFRGRLYENEDGDERRGRLDREERGGE 153
>HRX_MOUSE (P55200) Zinc finger protein HRX (ALL-1) (Fragment)| Length = 3866 Score = 32.3 bits (72), Expect = 0.66 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = +2 Query: 14 PKPKLQSIQTQRAPKI-----SSHTPPPPCPGAKRHRRRLTHPTPSPPTR 148 P+P + Q + APK PPPP PG ++ +++ P PS P + Sbjct: 1206 PQPPSTAPQKKEAPKAVPSEPKKKQPPPPEPGPEQSKQKKVAPLPSIPVK 1255
>WIRE_HUMAN (Q8TF74) WIP-related protein (WASP-interacting protein-related| protein) (WIP-and CR16-homologous protein) Length = 440 Score = 31.6 bits (70), Expect = 1.1 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSP 139 PDL +P S K SS PPPP PG RR PTP P Sbjct: 157 PDLSRPNTTS---STGMKHSSSAPPPPPPG----RRANAPPTPLP 194 Score = 29.6 bits (65), Expect = 4.3 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSP 139 P P P + + +AP + P PP PG + H R P P P Sbjct: 189 PPTPLP----MHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPPP 229
>CCDC9_HUMAN (Q9Y3X0) Coiled-coil domain-containing protein 9| Length = 531 Score = 30.8 bits (68), Expect = 1.9 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Frame = -3 Query: 226 PMSDMQAGVESAVTRRGRNEGGDE--------ENARGGRRSWVGEAPAVTLSSRARRR 77 P+ + + R GRN GG + E+ R GRR+ +G A +TLS R R Sbjct: 204 PLEESERDRREESRRHGRNWGGPDFERVRCGLEHERQGRRAGLGSAGDMTLSMTGRER 261
>BRD4_MOUSE (Q9ESU6) Bromodomain-containing protein 4 (Mitotic| chromosome-associated protein) (MCAP) Length = 1400 Score = 30.8 bits (68), Expect = 1.9 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +2 Query: 14 PKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPP 142 P P L S++ Q P PPPP P ++ + + P P PP Sbjct: 943 PTPLLPSVKVQSQP--PPPLPPPPHPSVQQQQLQPQPPPPPPP 983 Score = 28.5 bits (62), Expect = 9.6 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSP 139 P LP P S+Q Q ++ PPPP P + ++ P P P Sbjct: 958 PPLPPPPHPSVQQQ---QLQPQPPPPPPPQPQPPPQQQHQPPPRP 999
>FBRL_SCHPO (P35551) Fibrillarin| Length = 305 Score = 30.8 bits (68), Expect = 1.9 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -3 Query: 259 GRRGGQGGSQEPMSDMQAGVESAVTRRGRNEGGDEENARGGR 134 G RGG+GGS+ G RG GG ARGGR Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGR 47
>WIRE_MOUSE (Q6PEV3) WIP-related protein (WASP-interacting protein-related| protein) Length = 440 Score = 30.8 bits (68), Expect = 1.9 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSP 139 P P P + + +A + P PP PG + H R HP P P Sbjct: 189 PPTPLP----LHSNKAQAYNREKPLPPTPGQRLHPGREGHPAPPP 229 Score = 30.8 bits (68), Expect = 1.9 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSP 139 PDL +P S K SS PPPP PG RR PTP P Sbjct: 157 PDLSRPNTAS---GTGMKHSSSAPPPPPPG----RRANAPPTPLP 194
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 30.8 bits (68), Expect = 1.9 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 10/47 (21%) Frame = +2 Query: 329 RWMVMGASGS--KLEKALGDQFPEG--------ERYFGLENFGNTCY 439 RWM M + GS + + + P+ +R++GL N+GNTCY Sbjct: 5 RWMGMNSPGSTDRRKSTWEAELPKPSIRPETLTDRFYGLTNYGNTCY 51
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 30.4 bits (67), Expect = 2.5 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = +2 Query: 20 PKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHP----TPSPPTR 148 P + +R+P + PPPP P R RR T P TPSPP R Sbjct: 562 PSPPPARRRRSPSPAPPPPPPPPP--PRRRRSPTPPPRRRTPSPPPR 606
>FBRL_YEAST (P15646) Fibrillarin (Nucleolar protein 1)| Length = 327 Score = 30.0 bits (66), Expect = 3.3 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = -3 Query: 259 GRRGGQGGSQEPMSDMQAGVESAVTRRGRNEGGDEENARGGRRSWVGEA 113 G RGG GG + G RG + GG +RGGR G A Sbjct: 32 GSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGRGGAAGGA 80 Score = 28.9 bits (63), Expect = 7.3 Identities = 20/66 (30%), Positives = 23/66 (34%) Frame = -3 Query: 259 GRRGGQGGSQEPMSDMQAGVESAVTRRGRNEGGDEENARGGRRSWVGEAPAVTLSSRARR 80 G RGG GG + G RG + GG +RGG G SR R Sbjct: 14 GSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGR 73 Query: 79 RWRMGG 62 GG Sbjct: 74 GGAAGG 79
>UBP13_HUMAN (Q92995) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) (Isopeptidase T-3) (ISOT-3) Length = 863 Score = 30.0 bits (66), Expect = 3.3 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 332 WMVMGASGSKLEKALGDQFPEGERYFGLENFGNTCY 439 W V+ SG+KL+ G Y GL+N GN+CY Sbjct: 317 WEVIQESGTKLKPMYGPG------YTGLKNLGNSCY 346
>FETUA_CAVPO (O70159) Alpha-2-HS-glycoprotein precursor (Fetuin-A)| Length = 358 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 8/43 (18%) Frame = +2 Query: 2 YPDLPKPKLQSIQTQRAPKIS--------SHTPPPPCPGAKRH 106 +PD+ ++ ++ PK++ PPPPCPG RH Sbjct: 313 FPDVDSASGEAFGPRQKPKVTHPGVASGVGPVPPPPCPGRIRH 355
>CN004_MOUSE (Q8K3X4) Protein C14orf4 homolog| Length = 775 Score = 30.0 bits (66), Expect = 3.3 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +2 Query: 50 APKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRVFFIAALVS 175 AP S+ PPPP P H R T P +P +AAL+S Sbjct: 567 APGHSAGGPPPPPPPLGPHSNRTTPPESAPQNGPSPMAALMS 608
>FBRL_ASHGO (Q756P0) Fibrillarin| Length = 326 Score = 30.0 bits (66), Expect = 3.3 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = -3 Query: 259 GRRGGQGGSQEPMSDMQAGVESAVTRRGRNEGGDEENARGGRRSWVGEA 113 G RGG+GG D + G RG + GG RGG R G A Sbjct: 34 GSRGGRGGF-----DSRGGARGGFGGRGGSRGGPRGGPRGGARGGRGGA 77
>UBP1_HUMAN (O94782) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) (hUBP) Length = 785 Score = 24.3 bits (51), Expect(2) = 4.2 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 404 YFGLENFGNTCY 439 + GL N GNTCY Sbjct: 80 FVGLNNLGNTCY 91 Score = 23.9 bits (50), Expect(2) = 4.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 439 LHSVLQALYFCTPF 480 L+S+LQ LYFC F Sbjct: 92 LNSILQVLYFCPGF 105
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 29.6 bits (65), Expect = 4.3 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 5/50 (10%) Frame = +2 Query: 14 PKPKLQSIQTQRAPKISSHTPPP---PCPGAKRHRRRLT--HPTPSPPTR 148 P PK ++ + ++ + SH+PPP P AKR ++ H SPP+R Sbjct: 612 PPPKRRASPSPQSKRRVSHSPPPKQRSSPAAKRRSPSISSKHRKGSPPSR 661
>AGO1_ARATH (O04379) Argonaute protein| Length = 1048 Score = 29.6 bits (65), Expect = 4.3 Identities = 18/51 (35%), Positives = 21/51 (41%) Frame = -3 Query: 259 GRRGGQGGSQEPMSDMQAGVESAVTRRGRNEGGDEENARGGRRSWVGEAPA 107 G RGG+G Q P Q G RGR G + RGG G P+ Sbjct: 57 GGRGGRGYGQPPQQQQQYGGPQEYQGRGRG-GPPHQGGRGGYGGGRGGGPS 106
>YMH7_CAEEL (P34474) Hypothetical protein F58A4.7 in chromosome III| Length = 431 Score = 29.6 bits (65), Expect = 4.3 Identities = 20/72 (27%), Positives = 26/72 (36%) Frame = +2 Query: 74 PPPPCPGAKRHRRRLTHPTPSPPTRVFFIAALVSTPSXXXXXXXXXXXXXXXXXSALASP 253 PPP P + + PTP PP V + +STPS S L Sbjct: 302 PPPTLPSLET---TVIRPTPLPPISVEISSPSLSTPSPLTAAPIIFSTAVPTQSSILFQT 358 Query: 254 AAERSRSGLGSG 289 AA S + +G Sbjct: 359 AAAAVTSAMSTG 370
>ATN1_RAT (P54258) Atrophin-1 (Dentatorubral-pallidoluysian atrophy protein)| Length = 1183 Score = 29.6 bits (65), Expect = 4.3 Identities = 20/59 (33%), Positives = 23/59 (38%), Gaps = 11/59 (18%) Frame = +2 Query: 2 YP-DLPKPKLQSIQTQ----RAPKISSHT------PPPPCPGAKRHRRRLTHPTPSPPT 145 YP P P S+ Q P + S PPPP P + THP P PPT Sbjct: 406 YPHSFPPPTSMSVSNQPPKYTQPSLPSQAVWSQGPPPPPPPYGRLLPNNNTHPGPFPPT 464
>CPXM2_HUMAN (Q8N436) Carboxypeptidase-like protein X2 precursor| Length = 756 Score = 29.6 bits (65), Expect = 4.3 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRR 112 P P+P ++ + ++APK P PP PG +++ Sbjct: 73 PQEPRPPKRATKPKKAPKREKSAPEPPPPGKHSNKK 108
>ALR_RAT (Q63042) Augmenter of liver regeneration| Length = 125 Score = 29.6 bits (65), Expect = 4.3 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = +2 Query: 2 YPDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRVFF 157 YPD+P P+ Q Q S P C A+ R+R+ P TRV F Sbjct: 37 YPDMPTPEQQQDMAQFIHIFSKFYPCEEC--AEDIRKRIDRSQPDTSTRVSF 86
>PROP_PONPY (Q5RBP8) Properdin precursor (Factor P)| Length = 469 Score = 29.3 bits (64), Expect = 5.6 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 Query: 17 KPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSP 139 +PK + AP+ S P PCPG +RR T P P Sbjct: 215 EPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCP 255
>PROP_HUMAN (P27918) Properdin precursor (Factor P)| Length = 469 Score = 29.3 bits (64), Expect = 5.6 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 Query: 17 KPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSP 139 +PK + AP+ S P PCPG +RR T P P Sbjct: 215 EPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCP 255
>HCN4_MOUSE (O70507) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 4 (Brain cyclic nucleotide gated channel 3) (BCNG-3) Length = 1186 Score = 29.3 bits (64), Expect = 5.6 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 47 RAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPT 145 R+P+ + PPPP PGA+ L H P PP+ Sbjct: 920 RSPQAAQ--PPPPLPGARGGLGLLEHFLPPPPS 950
>EXTN_MAIZE (P14918) Extensin precursor (Proline-rich glycoprotein)| Length = 267 Score = 29.3 bits (64), Expect = 5.6 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPT 145 P PKP + P TPP P K + P P+PPT Sbjct: 189 PPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPT 235 Score = 29.3 bits (64), Expect = 5.6 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPT 145 P PKP + P TPP P K + P P+PPT Sbjct: 85 PPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPT 131 Score = 29.3 bits (64), Expect = 5.6 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPT 145 P PKP + P TPP P K + P P+PPT Sbjct: 48 PPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPTPKPTPPT 94 Score = 28.5 bits (62), Expect = 9.6 Identities = 18/59 (30%), Positives = 21/59 (35%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRVFFIAALVSTP 181 P PKP + P TPP P K THPTP P + + TP Sbjct: 138 PPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPP----THPTPKPTPPTYTPSPKPPTP 192
>CDC25_CANAL (P43069) Cell division control protein 25| Length = 1333 Score = 29.3 bits (64), Expect = 5.6 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 Query: 278 LGSGFRYLTGAATGWWDRWMVMGASG 355 LG L+ +ATGWWD +VMG SG Sbjct: 53 LGDTIHVLSKSATGWWD-GVVMGNSG 77
>TULP1_HUMAN (O00294) Tubby-related protein 1 (Tubby-like protein 1)| Length = 542 Score = 29.3 bits (64), Expect = 5.6 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 9/54 (16%) Frame = +2 Query: 5 PDLPK-PKLQSIQTQRAPKISSHTPPPPC--------PGAKRHRRRLTHPTPSP 139 P+ P+ PK + QR K + P PC PGA R R P+P P Sbjct: 25 PEAPRRPKQRPAPAQRLRKKRTEAPESPCPTGSKPRKPGAGRRGRPREEPSPDP 78
>HCN4_RAT (Q9JKA7) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 4 Length = 1198 Score = 29.3 bits (64), Expect = 5.6 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 47 RAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPT 145 R+P+ + PPPP PGA+ L H P PP+ Sbjct: 933 RSPQAAQ--PPPPLPGARGGLGLLEHFLPPPPS 963
>WASIP_HUMAN (O43516) Wiskott-Aldrich syndrome protein-interacting protein| (WASP-interacting protein) (PRPL-2 protein) Length = 503 Score = 28.9 bits (63), Expect = 7.3 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Frame = +2 Query: 5 PDLPKPKLQSIQTQRAPK----ISSHTPPPPCPGAKRHRRRLTHPTPSPPT 145 P LP + +T R P+ +SS TPP P PG + P P PP+ Sbjct: 319 PPLPPSSSGNDETPRLPQRNLSLSSSTPPLPSPGR-------SGPLPPPPS 362
>NO20_MEDTR (P93329) Early nodulin 20 precursor (N-20)| Length = 268 Score = 28.9 bits (63), Expect = 7.3 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Frame = +2 Query: 50 APKISSHTPPPPCPGAKRHRRRLTHP----TPSPPT 145 AP +SS PPPP P R + HP PSPP+ Sbjct: 130 APVLSS-PPPPPSPPTPRSSTPIPHPPRRSLPSPPS 164
>EXTN_DAUCA (P06599) Extensin precursor| Length = 306 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 47 RAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRVF 154 ++P H+PPPP P K +P PPT V+ Sbjct: 234 KSPPPPEHSPPPPTPVYKYKSPPPPMHSPPPPTPVY 269
>CN004_HUMAN (Q9H1B7) Protein C14orf4| Length = 796 Score = 28.9 bits (63), Expect = 7.3 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 50 APKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRVFFIAALVS 175 AP ++ PPPP P H R T P +P +AAL+S Sbjct: 588 APGHAAGGPPPPPPPLGPHSNRTTPPESAPQNGPSPMAALMS 629
>TPS1_MOUSE (O70281) Protein-tyrosine sulfotransferase 1 (EC 2.8.2.20)| (Tyrosylprotein sulfotransferase-1) (TPST-1) Length = 370 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = -1 Query: 390 GNWSPRAFSSLEPLAPMTIHRSHHPVAAPVRYRKPDP 280 G P + +APM + P A P Y KPDP Sbjct: 304 GKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDP 340
>TPS1_HUMAN (O60507) Protein-tyrosine sulfotransferase 1 (EC 2.8.2.20)| (Tyrosylprotein sulfotransferase-1) (TPST-1) Length = 370 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = -1 Query: 390 GNWSPRAFSSLEPLAPMTIHRSHHPVAAPVRYRKPDP 280 G P + +APM + P A P Y KPDP Sbjct: 304 GKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDP 340
>ALR_HUMAN (P55789) Augmenter of liver regeneration (hERV1 protein)| Length = 125 Score = 28.9 bits (63), Expect = 7.3 Identities = 19/52 (36%), Positives = 22/52 (42%) Frame = +2 Query: 2 YPDLPKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRVFF 157 YPDLP P+ Q Q S P C A+ R+RL P TR F Sbjct: 37 YPDLPTPEQQQDMAQFIHLFSKFYPCEEC--AEDLRKRLCRNHPDTRTRACF 86
>AB1IP_XENLA (Q6DCV1) Amyloid beta A4 precursor protein-binding family B member| 1-interacting protein (APBB1-interacting protein 1) Length = 653 Score = 28.9 bits (63), Expect = 7.3 Identities = 16/55 (29%), Positives = 21/55 (38%) Frame = +2 Query: 14 PKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRVFFIAALVST 178 P P + +Q AP PPPP P A + P PP R + + T Sbjct: 572 PPPPVTQLQMSNAPA-PPPPPPPPAPAANVPPLPVKKHPPKPPKRQSIVGPMPGT 625
>ZYX_HUMAN (Q15942) Zyxin (Zyxin-2)| Length = 572 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +2 Query: 14 PKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRVF 154 PKPK+ P + PPP PGA+R + P PP F Sbjct: 32 PKPKVN-------PFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDF 71
>Y101_NPVAC (P25695) Hypothetical 41.5 kDa protein in P6.9-VP48 intergenic| region (P40) Length = 361 Score = 28.5 bits (62), Expect = 9.6 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +2 Query: 23 KLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRVFFIAA 166 K+Q +Q Q+ I+S T P C A+ R L H P P +R+++ AA Sbjct: 253 KIQMLQPQQY--INSGTEIPFCDDAEFLNRLLKHIDPYPLSRMYYNAA 298
>BRD4_HUMAN (O60885) Bromodomain-containing protein 4 (HUNK1 protein)| Length = 1362 Score = 28.5 bits (62), Expect = 9.6 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 14 PKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSP 139 P P L S++ Q P PPPP P ++ ++ P P P Sbjct: 941 PTPLLPSVKVQSQP--PPPLPPPPHPSVQQQLQQQPPPPPPP 980
>Y369_TREPA (O83384) Hypothetical protein TP0369 precursor| Length = 516 Score = 28.5 bits (62), Expect = 9.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 50 APKISSHTPPPPCPGAKRHRRRLTHPTPSP 139 AP+ +PPP P A + ++R P+P P Sbjct: 132 APRPHRPSPPPVSPSASKPKQRAVPPSPPP 161
>WASF1_HUMAN (Q92558) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) (Verprolin homology domain-containing protein 1) Length = 559 Score = 28.5 bits (62), Expect = 9.6 Identities = 19/51 (37%), Positives = 22/51 (43%) Frame = +2 Query: 29 QSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRVFFIAALVSTP 181 QS T R P S TPPPP P P PS + A++ STP Sbjct: 309 QSPATGRTPVFVSPTPPPPPP-----------PLPSALSTSSLRASMTSTP 348
>NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 precursor (Notch| 3) [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2321 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 80 PPCPGAKRHRRRLTHPTPSPPTRVFFIAALVSTP 181 P G +R RR ++ P P PP R + L++ P Sbjct: 3 PGARGRRRRRRPMSPPPPPPPVRALPLLLLLAGP 36
>CD2_HUMAN (P06729) T-cell surface antigen CD2 precursor (T-cell surface| antigen T11/Leu-5) (LFA-2) (LFA-3 receptor) (Erythrocyte receptor) (Rosette receptor) Length = 351 Score = 28.5 bits (62), Expect = 9.6 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +2 Query: 17 KPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPP 142 KP+ T + P S H PPPP HR + P PP Sbjct: 264 KPQQIPASTPQNPATSQHPPPPP-----GHRSQAPSHRPPPP 300
>3BP1_HUMAN (Q9Y3L3) SH3 domain-binding protein 1 (3BP-1)| Length = 701 Score = 28.5 bits (62), Expect = 9.6 Identities = 18/72 (25%), Positives = 27/72 (37%), Gaps = 1/72 (1%) Frame = +2 Query: 47 RAPKISSHTPP-PPCPGAKRHRRRLTHPTPSPPTRVFFIAALVSTPSXXXXXXXXXXXXX 223 RAP + PP PP P ++ RR P+P+ P +S P+ Sbjct: 615 RAPTVPPPLPPTPPQPARRQSRRSPASPSPASPGPASPSPVSLSNPAQVDLGAATAEGGA 674 Query: 224 XXXXSALASPAA 259 S + +P A Sbjct: 675 PEAISGVPTPPA 686
>RAPH1_HUMAN (Q70E73) Ras-associated and pleckstrin homology domains-containing| protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein) Length = 1302 Score = 28.5 bits (62), Expect = 9.6 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = +2 Query: 14 PKPKLQSIQTQRAPKISSHTPPPPCPGAKRHRRRLTHPTP--SPPTRVFFIAALVST 178 P P L+ Q Q +++ TPPPP P + P P +PP + I A ST Sbjct: 795 PPPPLKIHQVQHITQVAPPTPPPPPP--------IPAPLPPQAPPKPLVTIPAPTST 843
>KCNK4_HUMAN (Q9NYG8) Potassium channel subfamily K member 4 (TWIK-related| arachidonic acid-stimulated potassium channel protein) (TRAAK) (Two pore K(+) channel KT4.1) Length = 393 Score = 28.5 bits (62), Expect = 9.6 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = +2 Query: 74 PPPPCPGAKRHRRRLTHP-----TPSPPT 145 PPPPCP R R P PSPPT Sbjct: 305 PPPPCPAQPLGRPRSPSPPEKAQPPSPPT 333
>SMN_HUMAN (Q16637) Survival motor neuron protein (Component of gems 1)| (Gemin-1) Length = 294 Score = 28.5 bits (62), Expect = 9.6 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Frame = +2 Query: 14 PKPKLQSIQTQRAPKISSHTPPPPCPGAK----RHRRRLTHPTPSPP 142 P K +I+ + AP S PPPP PG + + + P P PP Sbjct: 176 PGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPP 222
>PHLB1_MOUSE (Q6PDH0) Pleckstrin homology-like domain family B member 1 (Protein| LL5-alpha) Length = 1371 Score = 28.5 bits (62), Expect = 9.6 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = -3 Query: 229 EPMSDMQAGVESAVTRRGRNEGGDEENARGGRRSWVGEAPAVTLSSRARRRW---RMGG 62 +P +G S+ + R +GG E G R + ++PA T+ + ARR R+GG Sbjct: 297 QPPQSRPSGSRSSDSPRLGRKGGHERPPSPGLRGLLTDSPAATVLAEARRTTESPRLGG 355
>CN108_HUMAN (Q9H0R1) Protein C14orf108 (Putative HIV-1 infection-related| protein) Length = 490 Score = 28.5 bits (62), Expect = 9.6 Identities = 19/46 (41%), Positives = 22/46 (47%) Frame = +2 Query: 44 QRAPKISSHTPPPPCPGAKRHRRRLTHPTPSPPTRVFFIAALVSTP 181 QRA + SH P P G R RR +PT RVF A+ V P Sbjct: 3 QRAVWLISHEPGTPLCGTVRFSRR--YPTVEKRARVFNGASYVPVP 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,911,600 Number of Sequences: 219361 Number of extensions: 1072358 Number of successful extensions: 6198 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 5108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6080 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)