| Clone Name | baet115h10 |
|---|---|
| Clone Library Name | barley_pub |
>APRR2_ARATH (Q6LA43) Two-component response regulator-like APRR2| (Pseudo-response regulator 2) (TOC2 protein) Length = 535 Score = 95.5 bits (236), Expect = 3e-20 Identities = 44/68 (64%), Positives = 56/68 (82%) Frame = +3 Query: 96 KVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRKHLMA 275 KVDWTPELH++FVQAVEQLG+D+A+PSRILELM LTRHN+ASHLQK+R HRK+++ Sbjct: 298 KVDWTPELHKKFVQAVEQLGVDQAIPSRILELM-KVGTLTRHNVASHLQKFRQHRKNILP 356 Query: 276 REAEAASW 299 ++ W Sbjct: 357 KDDHNHRW 364
>ARR18_ARATH (Q9FGT7) Two-component response regulator ARR18| Length = 635 Score = 76.6 bits (187), Expect = 1e-14 Identities = 38/62 (61%), Positives = 49/62 (79%) Frame = +3 Query: 84 RRKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRK 263 R+K +V W+ ELH++FV AV+QLGLDKAVP +IL+LM E LTR N+ASHLQKYR + K Sbjct: 192 RKKPRVVWSQELHQKFVSAVQQLGLDKAVPKKILDLMSIE-GLTRENVASHLQKYRLYLK 250 Query: 264 HL 269 + Sbjct: 251 KI 252
>ARR2_ARATH (Q9ZWJ9) Two-component response regulator ARR2 (Receiver-like| protein 5) Length = 664 Score = 72.0 bits (175), Expect = 3e-13 Identities = 37/75 (49%), Positives = 50/75 (66%) Frame = +3 Query: 87 RKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRKH 266 +K +V W+ ELH++FV AV QLG+DKAVP +ILE+M N LTR N+ASHLQKYR + + Sbjct: 215 KKPRVVWSVELHQQFVAAVNQLGVDKAVPKKILEMM-NVPGLTRENVASHLQKYRIYLRR 273 Query: 267 LMAREAEAASWTHKW 311 L + H + Sbjct: 274 LGGVSQHQGNMNHSF 288
>ARR12_ARATH (P62598) Two-component response regulator ARR12| Length = 596 Score = 71.2 bits (173), Expect = 6e-13 Identities = 34/62 (54%), Positives = 48/62 (77%) Frame = +3 Query: 84 RRKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRK 263 ++K +V WT ELH++FV AV QLG +KA+P +IL+LM N +LTR N+ASHLQK+R + K Sbjct: 193 QKKQRVVWTVELHKKFVAAVNQLGYEKAMPKKILDLM-NVEKLTRENVASHLQKFRLYLK 251 Query: 264 HL 269 + Sbjct: 252 RI 253
>ARR14_ARATH (Q8L9Y3) Two-component response regulator ARR14| Length = 382 Score = 71.2 bits (173), Expect = 6e-13 Identities = 36/68 (52%), Positives = 50/68 (73%) Frame = +3 Query: 87 RKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRKH 266 +K +V W+ ELH++FV AV +LG+DKAVP RILELM N L+R N+ASHLQK+R + K Sbjct: 199 KKSRVVWSIELHQQFVNAVNKLGIDKAVPKRILELM-NVPGLSRENVASHLQKFRLYLKR 257 Query: 267 LMAREAEA 290 L +++ Sbjct: 258 LSGEASQS 265
>ARR1_ARATH (Q940D0) Two-component response regulator ARR1| Length = 690 Score = 70.9 bits (172), Expect = 7e-13 Identities = 36/61 (59%), Positives = 47/61 (77%) Frame = +3 Query: 87 RKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRKH 266 +K +V W+ ELH++FV AV QLG++KAVP +ILELM N LTR N+ASHLQKYR + + Sbjct: 236 KKPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELM-NVPGLTRENVASHLQKYRIYLRR 294 Query: 267 L 269 L Sbjct: 295 L 295
>ARR21_ARATH (Q9LYP5) Putative two-component response regulator ARR21| Length = 592 Score = 67.4 bits (163), Expect = 8e-12 Identities = 32/55 (58%), Positives = 39/55 (70%) Frame = +3 Query: 87 RKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYR 251 +K K+ WT LH F+QA+ +GLDKAVP +IL M Y LTR N+ASHLQKYR Sbjct: 221 KKKKIQWTDSLHDLFLQAIRHIGLDKAVPKKILAFMSVPY-LTRENVASHLQKYR 274
>ARR10_ARATH (O49397) Two-component response regulator ARR10 (Receiver-like| protein 4) Length = 552 Score = 67.0 bits (162), Expect = 1e-11 Identities = 38/87 (43%), Positives = 57/87 (65%), Gaps = 4/87 (4%) Frame = +3 Query: 84 RRKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRK 263 ++K +V WT ELH +F+ AV+ LG+++AVP +IL+LM N +LTR N+ASHLQK+R K Sbjct: 181 QKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLM-NVDKLTRENVASHLQKFRVALK 239 Query: 264 HL----MAREAEAASWTHKWQMYAAAG 332 + + + AA +H QM + G Sbjct: 240 KVSDDAIQQANRAAIDSHFMQMNSQKG 266
>ARR20_ARATH (Q9LZJ8) Putative two-component response regulator ARR20| Length = 426 Score = 63.2 bits (152), Expect = 2e-10 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 4/63 (6%) Frame = +3 Query: 87 RKVKVDWTPELHRRFVQAVEQLG-LDKAVPSRILELMGNEYR---LTRHNIASHLQKYRS 254 +K ++ WTPELH +F AVE++G L+KA P IL+ M E LTR+N+ASHLQKYR Sbjct: 210 KKPRMQWTPELHHKFEVAVEKMGSLEKAFPKTILKYMQEELNVQGLTRNNVASHLQKYRQ 269 Query: 255 HRK 263 K Sbjct: 270 SSK 272
>ARR11_ARATH (Q9FXD6) Two-component response regulator ARR11 (Receiver-like| protein 3) Length = 521 Score = 61.6 bits (148), Expect = 5e-10 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = +3 Query: 87 RKVKVDWTPELHRRFVQAVEQLGLD-KAVPSRILELMGNEYRLTRHNIASHLQKYRSHRK 263 +K +V W+ ELH +FV AV Q+G D KA P +IL+LM + LTR N+ASHLQKYR + Sbjct: 192 KKARVVWSFELHHKFVNAVNQIGCDHKAGPKKILDLMNVPW-LTRENVASHLQKYRLYLS 250 Query: 264 HL 269 L Sbjct: 251 RL 252
>ARR13_ARATH (Q9ZVD3) Putative two-component response regulator ARR13| Length = 572 Score = 60.5 bits (145), Expect = 1e-09 Identities = 30/62 (48%), Positives = 41/62 (66%) Frame = +3 Query: 87 RKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRKH 266 +K K+ WT L F+QA++ +G DK VP +IL +M Y LTR N+ASHLQKYR K Sbjct: 224 KKKKIWWTNPLQDLFLQAIQHIGYDKVVPKKILAIMNVPY-LTRENVASHLQKYRLFVKR 282 Query: 267 LM 272 ++ Sbjct: 283 VV 284
>APRR4_ARATH (Q9FJ16) Putative two-component response regulator-like APRR4| (Pseudo-response regulator 4) Length = 292 Score = 55.8 bits (133), Expect = 2e-08 Identities = 26/52 (50%), Positives = 40/52 (76%) Frame = +3 Query: 87 RKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQ 242 +K +V W ELH+ F+ AV+ LGL++AVP +IL++M +Y ++R N+ASHLQ Sbjct: 222 KKRRVVWDEELHQNFLNAVDFLGLERAVPKKILDVMKVDY-ISRENVASHLQ 272
>MYBF_ARATH (Q700D9) Putative Myb family transcription factor At1g14600| Length = 255 Score = 52.8 bits (125), Expect = 2e-07 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Frame = +3 Query: 96 KVDWTPELHRRFVQAVEQLGLD-KAVPSRILELMGNEYRLTRHNIASHLQKYRSHRKHLM 272 ++ WTPELHR FV AV+ LG KA P +L++M + LT ++ SHLQ YR R L+ Sbjct: 25 RLRWTPELHRSFVHAVDLLGGQYKATPKLVLKIM-DVKGLTISHVKSHLQMYRGSRITLL 83 Query: 273 AREAEAAS 296 + E++S Sbjct: 84 GKPEESSS 91
>ARR19_ARATH (Q9M9B9) Putative two-component response regulator ARR19| Length = 407 Score = 52.0 bits (123), Expect = 4e-07 Identities = 28/76 (36%), Positives = 51/76 (67%), Gaps = 5/76 (6%) Frame = +3 Query: 87 RKVKVDWTPELHRRFVQAVEQL-GLDKAVPSRILELMGNEYR---LTRHNIASHLQKYRS 254 RK ++ WT ELH++F++A+E + G++KA P ++E + E R +TR N+ASHLQK+R Sbjct: 214 RKPRMTWTEELHQKFLEAIEIIGGIEKANPKVLVECL-QEMRIEGITRSNVASHLQKHRI 272 Query: 255 H-RKHLMAREAEAASW 299 + ++ + ++ + W Sbjct: 273 NLEENQIPQQTQGNGW 288
>V70K_TYMVC (P28478) 69 kDa protein| Length = 628 Score = 31.2 bits (69), Expect = 0.65 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = -1 Query: 188 LQDPRRHRL----VQPQLLHRLHEPPVQLRRPVHLH 93 L +PRRHR + P R PP +L+RPVHL+ Sbjct: 285 LPNPRRHRTSTGHIPPTTTSRPTGPPSRLQRPVHLY 320
>V70K_TYMV (P10357) 69 kDa protein| Length = 628 Score = 31.2 bits (69), Expect = 0.65 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = -1 Query: 188 LQDPRRHRL----VQPQLLHRLHEPPVQLRRPVHLH 93 L +PRRHR + P R PP +L+RPVHL+ Sbjct: 285 LPNPRRHRTSTGHIPPTTTSRPTGPPSRLQRPVHLY 320
>V70K_TYMVA (P20131) 69 kDa protein| Length = 628 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -1 Query: 188 LQDPRRHRL----VQPQLLHRLHEPPVQLRRPVHLH 93 L +PRRHR + R PP +L+RPVHLH Sbjct: 285 LPNPRRHRTSTGHIPSTTASRPTGPPSRLQRPVHLH 320
>CCNB_DROME (P20439) G2/mitotic-specific cyclin-B| Length = 530 Score = 29.6 bits (65), Expect = 1.9 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 78 HGRRKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYR 209 H R V +DW E+H +F A E L A+ R L+++ + R Sbjct: 287 HKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKR 330
>ADD_PHOLL (Q7N4H5) Adenosine deaminase (EC 3.5.4.4) (Adenosine| aminohydrolase) Length = 333 Score = 29.3 bits (64), Expect = 2.5 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = +3 Query: 183 LELMGNEYRLTRHNIASHLQKYRSHRKHLMAREAEAASWTHKWQMYAAAGGPR 341 L+L G+E H SH K R H+ EAA WQ G R Sbjct: 166 LDLAGDELGFPGHLFQSHFTKARDAGWHITIHAGEAAGAESIWQAIRELGATR 218
>CU093_HUMAN (P59091) Protein C21orf93| Length = 139 Score = 29.3 bits (64), Expect = 2.5 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -1 Query: 173 RHRLVQPQLLHRLHEPPVQLRRPVHLHL---PPAVGALG 66 RH+ Q+ R H P L RP H+H PP V ALG Sbjct: 100 RHQTEPVQVASRWHVPSDGLCRPCHVHQLLHPPLVPALG 138
>KR10A_HUMAN (P60014) Keratin-associated protein 10-10 (Keratin-associated| protein 10.10) (High sulfur keratin-associated protein 10.10) (Keratin-associated protein 18-10) (Keratin-associated protein 18.10) Length = 251 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -2 Query: 169 TALSSPSCSTACTNRRCNSGVQSTFT 92 + +SSP C TAC C SG S+ T Sbjct: 46 SCVSSPCCQTACEPSACQSGYTSSCT 71
>GATM_MOUSE (Q9D964) Glycine amidinotransferase, mitochondrial precursor (EC| 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase) (AT) Length = 423 Score = 28.9 bits (63), Expect = 3.2 Identities = 21/73 (28%), Positives = 31/73 (42%) Frame = +3 Query: 84 RRKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRK 263 RR +DW+ + E GL A+P IL ++GNE S +YR++R Sbjct: 142 RRPDPIDWSLKYK---TPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRS 198 Query: 264 HLMAREAEAASWT 302 + A WT Sbjct: 199 IIKDYFHRGAKWT 211
>GATM_PONPY (Q5RFB9) Glycine amidinotransferase, mitochondrial precursor (EC| 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase) (AT) Length = 423 Score = 28.5 bits (62), Expect = 4.2 Identities = 21/73 (28%), Positives = 31/73 (42%) Frame = +3 Query: 84 RRKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRK 263 RR +DW+ + E GL A+P IL ++GNE S +YR++R Sbjct: 142 RRPDPIDWSLKYK---TPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRS 198 Query: 264 HLMAREAEAASWT 302 + A WT Sbjct: 199 IIKDYFHRGAKWT 211
>GATM_MACFA (Q4R806) Glycine amidinotransferase, mitochondrial precursor (EC| 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase) (AT) Length = 423 Score = 28.5 bits (62), Expect = 4.2 Identities = 21/73 (28%), Positives = 31/73 (42%) Frame = +3 Query: 84 RRKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRK 263 RR +DW+ + E GL A+P IL ++GNE S +YR++R Sbjct: 142 RRPDPIDWSLKYK---TPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRS 198 Query: 264 HLMAREAEAASWT 302 + A WT Sbjct: 199 IIKDYFHRGAKWT 211
>GATM_HUMAN (P50440) Glycine amidinotransferase, mitochondrial precursor (EC| 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase) (AT) Length = 423 Score = 28.5 bits (62), Expect = 4.2 Identities = 21/73 (28%), Positives = 31/73 (42%) Frame = +3 Query: 84 RRKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRK 263 RR +DW+ + E GL A+P IL ++GNE S +YR++R Sbjct: 142 RRPDPIDWSLKYK---TPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRS 198 Query: 264 HLMAREAEAASWT 302 + A WT Sbjct: 199 IIKDYFHRGAKWT 211
>VLTF_BPT5 (P13390) L-shaped tail fiber protein (Protein ltf)| Length = 1396 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 157 WTRRCRRGSWSSWATSTVS 213 +TR C G+WS+W S VS Sbjct: 774 FTRYCSNGTWSAWRESVVS 792
>PBPA_PSEAE (Q07806) Penicillin-binding protein 1A (PBP-1a) (PBP1a) [Includes:| Penicillin-insensitive transglycosylase (EC 2.4.2.-) (Peptidoglycan TGase); Penicillin-sensitive transpeptidase (EC 3.4.-.-) (DD-transpeptidase)] Length = 822 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 44 EDVGSRSDQELPRQAEGEGGLD 109 ED G+ D E P AEGEG ++ Sbjct: 618 EDAGNPGDPEHPESAEGEGSIE 639
>ELOA2_HUMAN (Q8IYF1) RNA polymerase II transcription factor SIII subunit A2| (Elongin A2) (EloA2) (Transcription elongation factor B polypeptide 3B) Length = 753 Score = 27.7 bits (60), Expect = 7.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 200 RVPSHAPQHRQPSPEVPVTQEAP 268 R PSH+P+HR+ + P Q+ P Sbjct: 120 RSPSHSPEHRRTARRTPPGQQRP 142
>AADAT_HUMAN (Q8N5Z0) Kynurenine/alpha-aminoadipate aminotransferase| mitochondrial precursor (KAT/AadAT) (Kynurenine--oxoglutarate transaminase II) (EC 2.6.1.7) (Kynurenine aminotransferase II) (Kynurenine--oxoglutarate aminotransferase II) (2-aminoadipat Length = 425 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 155 PQLLHRLHEPPVQLRRPVHLHLPPAVGALGRC 60 P+LL L + ++L P +H PP+ G + C Sbjct: 81 PELLSWLKQLQIKLHNPPTIHYPPSQGQMDLC 112
>PDR15_YEAST (Q04182) ATP-dependent permease PDR15| Length = 1529 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -2 Query: 355 AGASFLGPPAAAYICHLCVQLAASASLAIRCFLCDRYFWRW 233 AG +L P+A IC C A S + A Y+ RW Sbjct: 1453 AGTGYLSDPSATDICSFC---AVSTTNAFLATFSSHYYRRW 1490
>ELOA3_HUMAN (Q8NG57) RNA polymerase II transcription factor SIII subunit A3| (Elongin A3) (EloA3) (Transcription elongation factor B polypeptide 3C) Length = 546 Score = 27.7 bits (60), Expect = 7.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 200 RVPSHAPQHRQPSPEVPVTQEAP 268 R PSH+P+HR+ + P Q+ P Sbjct: 120 RSPSHSPEHRRTARRTPPGQQRP 142
>POL_HTLV2 (P03363) Pol polyprotein [Contains: Reverse| transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 982 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -1 Query: 194 HELQDPRRHRLVQPQLLHRLHEPPVQLRRPVHLHLPPAVGALG 66 H +DPR + PQ LH LH L+ L PA+ LG Sbjct: 376 HGYRDPRACITLTPQQLHALHAIQQALQHNCRGRLNPALPLLG 418
>GATM_RAT (P50442) Glycine amidinotransferase, mitochondrial precursor (EC| 2.1.4.1) (L-arginine:glycine amidinotransferase) (Transamidinase) (AT) Length = 423 Score = 27.7 bits (60), Expect = 7.2 Identities = 20/73 (27%), Positives = 31/73 (42%) Frame = +3 Query: 84 RRKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRK 263 +R +DW+ + E GL A+P IL ++GNE S +YR++R Sbjct: 142 KRPDPIDWSLKYK---TPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRS 198 Query: 264 HLMAREAEAASWT 302 + A WT Sbjct: 199 IIKDYFHRGAKWT 211
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 78 HGRRKVKVDWTPELHRRFVQAVEQLGLDK 164 H + + +DW PE+ +R+ VE G K Sbjct: 695 HAQPYIAIDWEPEMKKRYYDEVEAEGYVK 723
>UBP11_CANFA (Q01988) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 445 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 78 HGRRKVKVDWTPELHRRFVQAVEQLGLDK 164 H + + +DW PE+ +R+ VE G K Sbjct: 220 HAQPYIAIDWEPEMKKRYYDEVEAEGYVK 248
>RW1_MOUSE (O70472) RW1 protein| Length = 1829 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +2 Query: 209 SHAP--QHRQPSPEVPVTQEAP 268 SH+P QH QP P VP QE P Sbjct: 1244 SHSPLEQHSQPPPPVPQHQEPP 1265
>GATM_PIG (P50441) Glycine amidinotransferase (EC 2.1.4.1)| (L-arginine:glycine amidinotransferase) (Transamidinase) (AT) Length = 386 Score = 27.3 bits (59), Expect = 9.4 Identities = 20/73 (27%), Positives = 31/73 (42%) Frame = +3 Query: 84 RRKVKVDWTPELHRRFVQAVEQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRK 263 RR +DW+ + E GL A+P IL ++GNE + +YR++R Sbjct: 105 RRPDPIDWSVKYK---TPDFESTGLYGAMPRDILIVVGNEIIEAPMAWRARFFEYRAYRS 161 Query: 264 HLMAREAEAASWT 302 + A WT Sbjct: 162 IIKDYFRRGAKWT 174
>PRP33_DAUCA (P06600) Proline-rich 33 kDa extensin-related protein precursor| (Fragment) Length = 211 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -1 Query: 170 HRLVQPQLLHR--LHEPPVQLRRPVH 99 H + +PQ +HR +H+PP + + PVH Sbjct: 126 HPIHKPQPIHRPPVHKPPTEHKPPVH 151
>YEHP_ECOLI (P33352) Hypothetical protein yehP| Length = 378 Score = 27.3 bits (59), Expect = 9.4 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +3 Query: 102 DWTPELHRRFVQAV-EQLGLDKAVPSRILELMGNEYRLTRHNIASHLQKYRSHRKHLMAR 278 +W +H F Q V E+L D + I +++ N L R + L + H KHLM Sbjct: 71 EWINSIHTLFPQQVIERLESDAVLRYGIEDVVTNLDVLERMQPSESLLRAVLHTKHLMNP 130 Query: 279 EAEAAS 296 E AA+ Sbjct: 131 EVLAAA 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.121 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,694,830 Number of Sequences: 219361 Number of extensions: 674119 Number of successful extensions: 3106 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 2957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3091 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)