| Clone Name | baet115e08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PLSC_NEIMA (Q9JU41) 1-acyl-sn-glycerol-3-phosphate acyltransfera... | 31 | 1.4 | 2 | PLSC_NEIGO (Q59601) 1-acyl-sn-glycerol-3-phosphate acyltransfera... | 31 | 1.4 | 3 | PLSC_NEIMB (Q9JZ47) 1-acyl-sn-glycerol-3-phosphate acyltransfera... | 31 | 1.8 |
|---|
>PLSC_NEIMA (Q9JU41) 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC| 2.3.1.51) (1-AGP acyltransferase) (1-AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) Length = 255 Score = 31.2 bits (69), Expect = 1.4 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 293 TAKETARPPYTSLGLPRRPTRAYALRSISFSVS-VTITDAA 174 T K TARP Y +GLP R +++ ++ V V + DAA Sbjct: 187 TGKRTARPSYADVGLPTCLWRIVSMKKLTIKVDFVCVADAA 227
>PLSC_NEIGO (Q59601) 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC| 2.3.1.51) (1-AGP acyltransferase) (1-AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) Length = 255 Score = 31.2 bits (69), Expect = 1.4 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 293 TAKETARPPYTSLGLPRRPTRAYALRSISFSVS-VTITDAA 174 T K TARP Y +GLP R +++ ++ V V + DAA Sbjct: 187 TGKRTARPSYADVGLPTCLWRIVSMKKLTIKVDFVCVADAA 227
>PLSC_NEIMB (Q9JZ47) 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC| 2.3.1.51) (1-AGP acyltransferase) (1-AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) Length = 255 Score = 30.8 bits (68), Expect = 1.8 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 293 TAKETARPPYTSLGLPRRPTRAYALRSISFSVS-VTITDAA 174 T K TARP Y +GLP R +++ ++ V V + DAA Sbjct: 187 TGKRTARPSYADVGLPTCLWRIVSMKKLTIRVDFVCVADAA 227 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,291,022 Number of Sequences: 219361 Number of extensions: 534091 Number of successful extensions: 1798 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1798 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)