| Clone Name | baet114d05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SALAT_PAPSO (Q94FT4) Salutaridinol 7-O-acetyltransferase (EC 2.3... | 29 | 7.8 |
|---|
>SALAT_PAPSO (Q94FT4) Salutaridinol 7-O-acetyltransferase (EC 2.3.1.150) (salAT)| Length = 474 Score = 28.9 bits (63), Expect = 7.8 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = +2 Query: 158 LATFDLPYITFYYNQKLLLYRL----AEGAGDFQDVTARMADALGDALAYFYPLAGRI 319 L+ D + +YY +L Y + G+ + D + +L L +FYP+AGR+ Sbjct: 32 LSLLDQCFPLYYYVPIILFYPATAANSTGSSNHHDDLDLLKSSLSKTLVHFYPMAGRM 89 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,827,850 Number of Sequences: 219361 Number of extensions: 304243 Number of successful extensions: 942 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)