| Clone Name | baet114b01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRMA_YERPS (Q66G58) tRNA (uracil-5-)-methyltransferase (EC 2.1.1... | 30 | 4.5 | 2 | TRMA_YERPE (Q8ZAA0) tRNA (uracil-5-)-methyltransferase (EC 2.1.1... | 30 | 4.5 |
|---|
>TRMA_YERPS (Q66G58) tRNA (uracil-5-)-methyltransferase (EC 2.1.1.35)| (tRNA(M-5-U54)-methyltransferase) (RUMT) Length = 367 Score = 29.6 bits (65), Expect = 4.5 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +2 Query: 59 LTNERFELMITRRIAWPLCRRRIIQISALSTFDGRIGA---YH 178 L N + ++T A PL RR++ QI LST G++ A YH Sbjct: 83 LINRLMDALMTAIRAEPLLRRKLFQIDYLSTLSGKLIASLLYH 125
>TRMA_YERPE (Q8ZAA0) tRNA (uracil-5-)-methyltransferase (EC 2.1.1.35)| (tRNA(M-5-U54)-methyltransferase) (RUMT) Length = 367 Score = 29.6 bits (65), Expect = 4.5 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +2 Query: 59 LTNERFELMITRRIAWPLCRRRIIQISALSTFDGRIGA---YH 178 L N + ++T A PL RR++ QI LST G++ A YH Sbjct: 83 LINRLMDALMTAIRAEPLLRRKLFQIDYLSTLSGKLIASLLYH 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,987,321 Number of Sequences: 219361 Number of extensions: 1372323 Number of successful extensions: 2716 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2716 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)