| Clone Name | baet113e08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YJHD_ECOLI (P39354) Hypothetical protein yjhD | 29 | 6.5 |
|---|
>YJHD_ECOLI (P39354) Hypothetical protein yjhD| Length = 76 Score = 29.3 bits (64), Expect = 6.5 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -1 Query: 464 HSRKSSLGAVSLPTERIDVCLLPPAPAADPHESLL 360 +S +S LG + RI V +L P P DPH L+ Sbjct: 38 YSEESLLGIIVTSVCRIKVAMLKPEPPRDPHIPLM 72 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,901,183 Number of Sequences: 219361 Number of extensions: 692917 Number of successful extensions: 2090 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2090 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)