| Clone Name | baet10f01 |
|---|---|
| Clone Library Name | barley_pub |
>CRD1_HORVU (Q5EFU4) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Protein Xantha-l) Length = 417 Score = 100 bits (248), Expect = 1e-21 Identities = 53/88 (60%), Positives = 53/88 (60%) Frame = +3 Query: 51 MASAMELSLLNPAMHHYGIAAKTASHLPXVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 230 MASAMELSLLNPAMHHYGIAAKTASHLP VP Sbjct: 1 MASAMELSLLNPAMHHYGIAAKTASHLPVVPARRASSGAVRFRVRAAAAAPPAPAAKPGS 60 Query: 231 XXXXXKTEVNESLLTPRFYTTDFDEMEQ 314 KTEVNESLLTPRFYTTDFDEMEQ Sbjct: 61 PKKRGKTEVNESLLTPRFYTTDFDEMEQ 88
>CRD1_EUPES (Q945B7) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 45.1 bits (105), Expect = 5e-05 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEME 311 K E+NE+LLTPRFYTTDFDEME Sbjct: 54 KKEINETLLTPRFYTTDFDEME 75
>CRD1_ARATH (Q9M591) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Copper response defect 1 protein) (Dicarboxylate diiron protein) (AtZIP Length = 409 Score = 44.3 bits (103), Expect = 8e-05 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEMEQ 314 K E+ ESLLTPRFYTTDF+EMEQ Sbjct: 58 KKEIQESLLTPRFYTTDFEEMEQ 80
>CRD1_GOSHI (Q6SJV8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 42.7 bits (99), Expect = 2e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEME 311 KT + E+LLTPRFYTTDFDEME Sbjct: 54 KTAIKETLLTPRFYTTDFDEME 75
>CRD1_CHLRE (Q9LD46) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) (Copper response defect 1 protein) (Copper-response target 1 protein Length = 407 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEMEQ 314 K E+LLTPRFYTTDFDEMEQ Sbjct: 56 KVAAKETLLTPRFYTTDFDEMEQ 78
>ACSF_GRATL (Q6B8U1) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 349 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEMEQ 314 +T V E+LLTPRFYTTDFDEM + Sbjct: 9 QTPVKETLLTPRFYTTDFDEMSK 31
>CTH1_CHLRE (Q9AR22) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 2, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 2) (Copper target homolog 1 protein) Length = 407 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEMEQ 314 K +E+LLTPRFYTTDFDEME+ Sbjct: 56 KVASDETLLTPRFYTTDFDEMER 78
>ACSF1_SYNY3 (P72584) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) Length = 358 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEM 308 KT E++LTPRFYTTDFDEM Sbjct: 18 KTPAKETILTPRFYTTDFDEM 38
>ACSF3_ANASP (Q8YRZ2) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 3 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 3) Length = 358 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEM 308 K E+LLTPRFYTTDFDEM Sbjct: 18 KVPAKETLLTPRFYTTDFDEM 38
>ACSF2_SYNY3 (P74134) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 2 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 2) Length = 358 Score = 36.2 bits (82), Expect = 0.021 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEM 308 K V E+LLTPRFYTTDFD++ Sbjct: 18 KAPVKETLLTPRFYTTDFDKV 38
>ACSF_SYNPX (Q7U6Y8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 356 Score = 35.8 bits (81), Expect = 0.028 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEM 308 K V +++LTPRFYTTDFD+M Sbjct: 16 KDPVKDTILTPRFYTTDFDDM 36
>ACSF2_ANASP (Q8YVU4) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 2 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 2) Length = 358 Score = 35.4 bits (80), Expect = 0.036 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFD 302 K V E+LLTPRFYTTDFD Sbjct: 18 KAPVQETLLTPRFYTTDFD 36
>ACSF_CYACA (Q9TLR8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 354 Score = 35.4 bits (80), Expect = 0.036 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEMEQ 314 K + E+LL PRFYTTDFDE+ + Sbjct: 11 KKTIKETLLAPRFYTTDFDEISR 33
>ACSF_PORPU (P51277) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 349 Score = 34.7 bits (78), Expect = 0.062 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +3 Query: 261 ESLLTPRFYTTDFDEM 308 E+LLTPRFYTTDF+EM Sbjct: 14 ETLLTPRFYTTDFEEM 29
>ACSF_CYAME (Q85FX6) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 335 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = +3 Query: 261 ESLLTPRFYTTDFDEM 308 ++LLTPRFYTTDFD+M Sbjct: 12 QTLLTPRFYTTDFDQM 27
>ACSF_SYNP6 (Q5MZZ2) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 358 Score = 33.1 bits (74), Expect = 0.18 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEM 308 K E++LTPRFYTTDF+ M Sbjct: 18 KAPAKETILTPRFYTTDFEAM 38
>ACSF1_SYNEL (Q8DJ05) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) Length = 380 Score = 33.1 bits (74), Expect = 0.18 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEM 308 K E++LTPRFYTTDF+ M Sbjct: 18 KAPAKETILTPRFYTTDFEAM 38
>ACSF_GLOVI (Q7NFA1) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 346 Score = 32.7 bits (73), Expect = 0.24 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEM 308 ++E E+LLTPRFYTTDF+ + Sbjct: 13 QSERRETLLTPRFYTTDFEAL 33
>ACSF2_SYNEL (Q8DI68) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 2 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 2) Length = 354 Score = 32.7 bits (73), Expect = 0.24 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = +3 Query: 255 VNESLLTPRFYTTDFDE 305 + E+LLTPRFYTTDF++ Sbjct: 17 IRENLLTPRFYTTDFEQ 33
>ACSF1_ANASP (Q8YX57) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) Length = 351 Score = 32.3 bits (72), Expect = 0.31 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFD 302 KT E++LTPRFYTTDF+ Sbjct: 11 KTPSKETVLTPRFYTTDFE 29
>ACSF_PROMP (Q7V1M1) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 390 Score = 31.2 bits (69), Expect = 0.69 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 246 KTEVNESLLTPRFYTTDFDEMEQ 314 K +++LTP FYTTDF+ ME+ Sbjct: 18 KDIAKDTILTPNFYTTDFEAMEK 40
>JJAZ_MOUSE (Q80U70) Polycomb protein Suz12 (Suppressor of zeste 12 protein| homolog) Length = 741 Score = 30.8 bits (68), Expect = 0.90 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -2 Query: 182 HAEADGAGRGPACGDXREVGGRFGGDAVVVHCGVEEGELHGG 57 H G G GP+ G GG FGG A V G+ GG Sbjct: 6 HGGGGGGGSGPSAGSG---GGGFGGSAAAVAAAASGGKSGGG 44
>ACSF_PROMM (Q7V3Y9) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 349 Score = 30.8 bits (68), Expect = 0.90 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 255 VNESLLTPRFYTTDFDE 305 ++++LLTPRFYTT+FD+ Sbjct: 23 LDDNLLTPRFYTTEFDK 39
>ACSF_PROMA (Q7VBV0) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 347 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/17 (64%), Positives = 17/17 (100%) Frame = +3 Query: 255 VNESLLTPRFYTTDFDE 305 ++E+LLTPRFYTT+F++ Sbjct: 21 LDENLLTPRFYTTEFEK 37
>SUZ12_HUMAN (Q15022) Polycomb protein SUZ12 (Suppressor of zeste 12 protein| homolog) (Joined to JAZF1 protein) (Chromatin precipitated E2F target 9 protein) (ChET 9 protein) Length = 739 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -2 Query: 182 HAEADGAGRGPACGDXREVGGRFGGDAVVVHCGVEEGELHGG 57 H G G GP+ G GG FGG A V G+ GG Sbjct: 6 HGGGGGGGSGPSAGSG---GGGFGGSAAVAAATASGGKSGGG 44
>UB2Q1_MOUSE (Q7TSS2) Ubiquitin-conjugating enzyme E2 Q1 (EC 6.3.2.19)| (Ubiquitin-protein ligase Q1) (Ubiquitin carrier protein Q1) Length = 422 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 Query: 179 AEADGAGRGPACGDXREVGGRFGGDAVVVHCGVEE 75 A A GAG G A G G GD V +HC + E Sbjct: 76 AGAGGAGAGAAPGPHLPSRGSVPGDPVRIHCNITE 110
>UB2Q1_HUMAN (Q7Z7E8) Ubiquitin-conjugating enzyme E2 Q1 (EC 6.3.2.19)| (Ubiquitin-protein ligase Q1) (Ubiquitin carrier protein Q1) (Protein NICE-5) Length = 422 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 Query: 179 AEADGAGRGPACGDXREVGGRFGGDAVVVHCGVEE 75 A A GAG G A G G GD V +HC + E Sbjct: 76 AGAGGAGAGAAPGPHLPPRGSVPGDPVRIHCNITE 110
>ACSF_RHOPA (Q6N9J7) Aerobic magnesium-protoporphyrin IX monomethyl ester| [oxidative] cyclase (EC 1.14.13.81) (Aerobic Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 365 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +3 Query: 261 ESLLTPRFYTTDFDEMEQ 314 +++LTPRFYTTD+ M++ Sbjct: 31 DTILTPRFYTTDYAAMDK 48
>CF1A_DROME (P16241) POU-domain protein CF1A (Chorion factor 1A) (CF1-A)| (Ventral veins lacking protein) (Drifter protein) Length = 427 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 33 THAPRKMASAMELSLLNPAMHHYGIAAKTASH-LPXVP 143 T +PR A A E+ + HH+ AA A H LP P Sbjct: 25 TSSPRSAADAGEMKYMQHHHHHHAAAAAAAHHQLPSSP 62
>FANCJ_CHICK (Q3YK19) Fanconi anemia group J protein homolog (EC 3.6.1.-)| (ATP-dependent RNA helicase BRIP1) (Protein FACJ) Length = 1252 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +2 Query: 5 SSLPFRAVCHSRSSED----GVRHGA 70 +SLP R VCHSRS G HGA Sbjct: 86 ASLPCRCVCHSRSESSEATAGASHGA 111
>GRP1_PETHY (P09789) Glycine-rich cell wall structural protein 1 precursor| Length = 384 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 161 GRGPACGDXREVGGRFGGDA 102 GRGP+ G R GG FGG A Sbjct: 56 GRGPSFGRGRGAGGGFGGGA 75
>NORM_RHILO (Q98D15) Probable multidrug resistance protein norM| (Multidrug-efflux transporter) Length = 467 Score = 27.7 bits (60), Expect = 7.6 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -3 Query: 247 LPRFFGEPGFXXXXXXXXXXALTRKRTAPEEARRAGTXGRWEAVLAAMP*WCI 89 +P FG G L R+R + + RR G W A+L ++P W + Sbjct: 67 MPLIFGL-GLMLATSPMIATELGRRRYSVRDLRRTVRQGLWLAILISIPIWIV 118
>FILA_HUMAN (P20930) Filaggrin| Length = 4061 Score = 27.3 bits (59), Expect = 9.9 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 7/58 (12%) Frame = -2 Query: 170 DGAGRGPACGDXREVGGRF-----GGDAVVVH--CGVEEGELHGGRHLPRSVSDRQRG 18 D AG G + R+ G R GG A H GE HG RH + S R G Sbjct: 3260 DRAGHGHSADRSRQSGTRHAETSSGGQAASSHEQARSSPGERHGSRHQQSADSSRHSG 3317
>EGG3_SCHMA (P13396) Eggshell protein precursor (Chorion protein)| Length = 177 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 167 GAGRGPAC--GDXREVGGRFGGDAVVVHCGVEEGELHGG 57 G G G C GD GG +GGD CG G GG Sbjct: 61 GGGYGGGCSGGDCGNYGGGYGGDCNGGDCGNYGGGYGGG 99
>EGG2_SCHMA (P12796) Eggshell protein precursor (Chorion protein)| Length = 177 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 167 GAGRGPAC--GDXREVGGRFGGDAVVVHCGVEEGELHGG 57 G G G C GD GG +GGD CG G GG Sbjct: 61 GGGYGGGCSGGDCGNYGGGYGGDCNGGDCGNYGGGYGGG 99
>GATE_PYRAE (Q8ZTJ3) Glutamyl-tRNA(Gln) amidotransferase subunit E (EC 6.3.5.-)| (Glu-ADT subunit E) Length = 608 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 161 GRGPACGDXREVGGRFGGDAVVVHCGVEEGEL 66 G G + REV R G ++ ++ GVEE EL Sbjct: 351 GYGITAEEVREVANRLGVESFILLMGVEESEL 382
>EGG1_SCHMA (P06649) Eggshell protein precursor (Chorion protein)| Length = 173 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 167 GAGRGPAC--GDXREVGGRFGGDAVVVHCGVEEGELHGG 57 G G G C GD GG +GGD CG G GG Sbjct: 57 GGGYGGGCSGGDCGNYGGGYGGDCNGGDCGNYGGGYGGG 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,164,895 Number of Sequences: 219361 Number of extensions: 435861 Number of successful extensions: 1681 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1678 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)