ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet10d04 |
|---|---|
| Clone Library Name | barley_pub |
>THN6_HORVU (P09618) Leaf-specific thionin BTH6 precursor [Contains:| Leaf-specific thionin BTH6; Acidic protein] Length = 137 Score = 54.3 bits (129), Expect = 9e-08 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = +3 Query: 60 MAPSKSIKXXXXXXXXXXXXXEQVQMEGKSCCKTTFARNCYN 185 MAPSKSIK EQVQ+EGKSCCK T ARNCYN Sbjct: 1 MAPSKSIKSVVICVLILVLVLEQVQVEGKSCCKDTLARNCYN 42
>THN3_HORVU (P08772) Leaf-specific thionin DB4 precursor [Contains:| Leaf-specific thionin DB4; Acidic protein] Length = 137 Score = 54.3 bits (129), Expect = 9e-08 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = +3 Query: 60 MAPSKSIKXXXXXXXXXXXXXEQVQMEGKSCCKTTFARNCYN 185 MAPSKSIK EQVQ+EGKSCCK T ARNCYN Sbjct: 1 MAPSKSIKSVVICVLILGLVLEQVQVEGKSCCKDTLARNCYN 42
>THNX_HORVU (Q8H0Q5) Probable leaf thionin precursor [Contains: Probable leaf| thionin; Acidic protein] Length = 137 Score = 48.1 bits (113), Expect = 6e-06 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = +3 Query: 60 MAPSKSIKXXXXXXXXXXXXXEQVQMEGKSCCKTTFARNCYN 185 MA +KSIK EQVQ+EGKSCCK T RNCYN Sbjct: 1 MATNKSIKSVVICVLILGLVLEQVQVEGKSCCKNTTGRNCYN 42
>THN7_HORVU (Q42838) Thionin BTH7 precursor [Contains: Thionin BTH7; Acidic| protein] Length = 137 Score = 48.1 bits (113), Expect = 6e-06 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = +3 Query: 60 MAPSKSIKXXXXXXXXXXXXXEQVQMEGKSCCKTTFARNCYN 185 MA +KSIK EQVQ+EGKSCCK T RNCYN Sbjct: 1 MATNKSIKSVVICVLILGLVLEQVQVEGKSCCKNTTGRNCYN 42
>THN5_HORVU (P09617) Leaf-specific thionin precursor [Contains: Leaf-specific| thionin; Acidic protein] Length = 137 Score = 45.8 bits (107), Expect = 3e-05 Identities = 22/42 (52%), Positives = 24/42 (57%) Frame = +3 Query: 60 MAPSKSIKXXXXXXXXXXXXXEQVQMEGKSCCKTTFARNCYN 185 MA +KSIK EQVQ+E KSCCK T RNCYN Sbjct: 1 MATNKSIKSVVICVLILGLVLEQVQVEAKSCCKNTTGRNCYN 42
>THN2_WHEAT (P32032) Alpha-2-purothionin precursor [Contains:| Alpha-2-purothionin; Acidic protein] Length = 136 Score = 45.1 bits (105), Expect = 5e-05 Identities = 20/39 (51%), Positives = 23/39 (58%) Frame = +3 Query: 69 SKSIKXXXXXXXXXXXXXEQVQMEGKSCCKTTFARNCYN 185 SK +K EQVQ+EGKSCC+TT RNCYN Sbjct: 3 SKGLKGVMVCLLILGLVLEQVQVEGKSCCRTTLGRNCYN 41
>THNB_WHEAT (P01543) Purothionin A-1 precursor (Purothionin A-I)| (Beta-purothionin) [Contains: Purothionin A-1; Acidic protein] Length = 136 Score = 44.7 bits (104), Expect = 7e-05 Identities = 20/39 (51%), Positives = 23/39 (58%) Frame = +3 Query: 69 SKSIKXXXXXXXXXXXXXEQVQMEGKSCCKTTFARNCYN 185 SK +K EQVQ+EGKSCCK+T RNCYN Sbjct: 3 SKGLKGVMVCLLILGLVLEQVQVEGKSCCKSTLGRNCYN 41
>THNA_HORVU (P01545) Alpha-hordothionin precursor (Purothionin II) [Contains:| Alpha-hordothionin; Acidic protein] Length = 127 Score = 42.7 bits (99), Expect = 3e-04 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = +3 Query: 123 EQVQMEGKSCCKTTFARNCYN 185 EQVQ+EGKSCC++T RNCYN Sbjct: 12 EQVQVEGKSCCRSTLGRNCYN 32
>THNB_HORVU (P21742) Beta-hordothionin precursor [Contains: Beta-hordothionin;| Acidic protein] Length = 136 Score = 41.6 bits (96), Expect = 6e-04 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 69 SKSIKXXXXXXXXXXXXXEQVQMEGKSCCKTTFARNCYN 185 SK +K E VQ+EGKSCC++T RNCYN Sbjct: 3 SKGLKGVMVCLLILGLVLEHVQVEGKSCCRSTLGRNCYN 41
>THN1_WHEAT (P01544) Alpha-1-purothionin precursor (Purothionin A-II)| [Contains: Alpha-1-purothionin; Acidic protein] (Fragment) Length = 126 Score = 41.6 bits (96), Expect = 6e-04 Identities = 15/21 (71%), Positives = 19/21 (90%) Frame = +3 Query: 123 EQVQMEGKSCCKTTFARNCYN 185 EQ+Q+EGKSCC++T RNCYN Sbjct: 10 EQLQVEGKSCCRSTLGRNCYN 30
>THN_PYRPU (P07504) Thionin| Length = 47 Score = 32.3 bits (72), Expect = 0.35 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +3 Query: 144 KSCCKTTFARNCYN 185 KSCC+ T+ARNCYN Sbjct: 1 KSCCRNTWARNCYN 14
>THND_HELPU (P60057) Hellethionin D| Length = 46 Score = 32.0 bits (71), Expect = 0.46 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 144 KSCCKTTFARNCYN 185 KSCC+ T ARNCYN Sbjct: 1 KSCCRNTLARNCYN 14
>THN3_VISAL (P01538) Viscotoxin A3 precursor [Contains: Viscotoxin A3; Acidic| protein] Length = 111 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 132 QMEGKSCCKTTFARNCYN 185 Q+E KSCC T RN YN Sbjct: 23 QVESKSCCPNTTGRNIYN 40
>THN_PHOTO (P01539) Phoratoxin| Length = 46 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 144 KSCCKTTFARNCYN 185 KSCC TT ARN YN Sbjct: 1 KSCCPTTTARNIYN 14
>XBP1_HUMAN (P17861) X box-binding protein 1 (XBP-1) (Tax-responsive| element-binding protein 5) Length = 261 Score = 27.7 bits (60), Expect = 8.7 Identities = 20/49 (40%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = -2 Query: 183 CNSFWQTW--SC-SNSFPPSGPAPELNLV*EHK*PHP*YSYWVPWLACW 46 C +FW TW SC SN+ P S PA + K P P Y P+L W Sbjct: 204 CWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVP---YQPPFLCQW 249 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,867,929 Number of Sequences: 219361 Number of extensions: 381627 Number of successful extensions: 995 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 995 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
