| Clone Name | baet102h07 |
|---|---|
| Clone Library Name | barley_pub |
>HRPJ_PSESY (Q05395) Hypersensitivity response secretion protein hrpJ| Length = 346 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -3 Query: 148 APPTRALRPVIPINACTLCITAAAGTEL 65 APPT +RPV PI A T A G+ L Sbjct: 5 APPTLPIRPVAPIRAITPAARAIPGSGL 32
>ADO_MOUSE (O54754) Aldehyde oxidase (EC 1.2.3.1) (Retinal oxidase)| Length = 1333 Score = 28.5 bits (62), Expect = 4.9 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -3 Query: 145 PPTRALRPVIPINACTLCITAAAGTELAGAYSVGNVRT 32 P T+A+R P+NAC I + GT + +GN RT Sbjct: 60 PSTKAIRHH-PVNACLTPICSLHGTAVTTVEGLGNTRT 96
>PCD15_MOUSE (Q99PJ1) Protocadherin-15 precursor| Length = 1943 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +2 Query: 152 APLCHPP--HAPMAATAVTLPTSAPSP 226 APL HPP P+A T LP S P+P Sbjct: 1749 APLPHPPLPRPPIAFTTFPLPLSPPNP 1775
>ADO_RAT (Q9Z0U5) Aldehyde oxidase (EC 1.2.3.1)| Length = 1333 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -3 Query: 145 PPTRALRPVIPINACTLCITAAAGTELAGAYSVGNVRT 32 P T+++R P+NAC I + GT + +GN RT Sbjct: 60 PSTKSIRHH-PVNACLTPICSLYGTAVTTVEGIGNTRT 96
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 146 SPAPLCHPPHAPMAATAVTLPTSAP 220 +PAP PP A A A T PTS P Sbjct: 18 APAPAATPPSAGAAPGAATPPTSGP 42
>MOBA_BRUSU (Q8G0X5) Probable molybdopterin-guanine dinucleotide biosynthesis| protein A Length = 221 Score = 27.7 bits (60), Expect = 8.4 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -2 Query: 206 AGSPPWLPLERAGDGRAGQGSTYARFTPSNSD*RLHPLYYRGCWH 72 A P+LP + A + Q T AR + S+ R+HP+ G WH Sbjct: 110 AADTPFLPCDLASNLIRKQAETGARIILACSNERVHPIV--GLWH 152
>MOBA_BRUME (Q8YGY5) Probable molybdopterin-guanine dinucleotide biosynthesis| protein A Length = 221 Score = 27.7 bits (60), Expect = 8.4 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -2 Query: 206 AGSPPWLPLERAGDGRAGQGSTYARFTPSNSD*RLHPLYYRGCWH 72 A P+LP + A + Q T AR + S+ R+HP+ G WH Sbjct: 110 AADTPFLPCDLASNLIRKQAETGARIILACSNERVHPIV--GLWH 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,029,189 Number of Sequences: 219361 Number of extensions: 625157 Number of successful extensions: 2373 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2372 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)