| Clone Name | baet102h01 |
|---|---|
| Clone Library Name | barley_pub |
>CHRD_XENLA (Q91713) Chordin precursor (Organizer-specific secreted dorsalizing| factor) Length = 941 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 120 CASPLLLSRSCCCTC-ASPLPNLSTSD 43 CA+P+LL CC TC +P P + SD Sbjct: 102 CANPILLPLHCCKTCPKAPPPPIKKSD 128
>GPR45_HUMAN (Q9Y5Y3) Probable G-protein coupled receptor 45 (PSP24-alpha)| (PSP24-1) Length = 372 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = -3 Query: 145 PTRSTARRLCLAIAAFSQLLLHLC---FTASEPLNERW 41 P +A L LA AFS ++L LC FTA + RW Sbjct: 63 PAMRSAINLLLATLAFSDIMLSLCCMPFTAVTLITVRW 100
>GPR45_MOUSE (Q9EQQ4) Probable G-protein coupled receptor 45 (PSP24-alpha)| (PSP24-1) Length = 373 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = -3 Query: 145 PTRSTARRLCLAIAAFSQLLLHLC---FTASEPLNERW 41 P +A L LA AFS ++L LC FTA + RW Sbjct: 63 PAMRSAINLLLATLAFSDIMLSLCCMPFTAITLITVRW 100
>ACM1_RAT (P08482) Muscarinic acetylcholine receptor M1| Length = 460 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -2 Query: 197 EAPASSGREAEAGGREQPDEEHGKEAVPRHCC 102 E P G + + R QP E E+ P CC Sbjct: 229 ETPGKGGGSSSSSERSQPGAEGSPESPPGRCC 260
>ACM1_MOUSE (P12657) Muscarinic acetylcholine receptor M1| Length = 460 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -2 Query: 197 EAPASSGREAEAGGREQPDEEHGKEAVPRHCC 102 E P G + + R QP E E+ P CC Sbjct: 229 ETPGKGGGSSSSSERSQPGAEGSPESPPGRCC 260
>ACM1_PIG (P04761) Muscarinic acetylcholine receptor M1| Length = 460 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -2 Query: 197 EAPASSGREAEAGGREQPDEEHGKEAVPRHCC 102 E P G + + R QP E E P CC Sbjct: 229 ETPGKGGGSSSSSERSQPGAEGSPETPPGRCC 260
>ACM1_MACMU (P56489) Muscarinic acetylcholine receptor M1| Length = 460 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -2 Query: 197 EAPASSGREAEAGGREQPDEEHGKEAVPRHCC 102 E P G + + R QP E E P CC Sbjct: 229 ETPGKGGGSSSSSERSQPGAEGSPETPPGRCC 260
>ACM1_HUMAN (P11229) Muscarinic acetylcholine receptor M1| Length = 460 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -2 Query: 197 EAPASSGREAEAGGREQPDEEHGKEAVPRHCC 102 E P G + + R QP E E P CC Sbjct: 229 ETPGKGGGSSSSSERSQPGAEGSPETPPGRCC 260 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,680,775 Number of Sequences: 219361 Number of extensions: 319044 Number of successful extensions: 1227 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1227 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)