| Clone Name | baet102f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATM_DEBHA (Q6BV76) Serine/threonine-protein kinase TEL1 (EC 2.7.... | 32 | 0.60 | 2 | AVT3_YEAST (P36062) Vacuolar amino acid transporter 3 | 28 | 8.7 |
|---|
>ATM_DEBHA (Q6BV76) Serine/threonine-protein kinase TEL1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase TEL1) (Telomere length regulation protein 1) (ATM homolog) Length = 2948 Score = 31.6 bits (70), Expect = 0.60 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +2 Query: 2 HKNISTQLSHTADQARSHS-FLAHFTSSSLMSSCFEASAMADLIPGLPEEVARECLIRV 175 HK T L D H + ++S L+S+ +E+ DLI GLPEE + E I + Sbjct: 1906 HKYFKTALMLFEDDVSKHEKHIDWLSNSRLLSNIYESIDNEDLIFGLPEETSLEYAINM 1964
>AVT3_YEAST (P36062) Vacuolar amino acid transporter 3| Length = 692 Score = 27.7 bits (60), Expect = 8.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 181 EPHPYEALPRHLLRQPRNQV 122 EPH +A+ RHL+R P N + Sbjct: 103 EPHVVDAVARHLIRNPSNSL 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,362,654 Number of Sequences: 219361 Number of extensions: 301685 Number of successful extensions: 949 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 949 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)