| Clone Name | baet102d03 |
|---|---|
| Clone Library Name | barley_pub |
>HSH2D_BRARE (Q56A36) Hematopoietic SH2 domain-containing protein homolog| Length = 365 Score = 30.0 bits (66), Expect = 3.1 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 7/56 (12%) Frame = +2 Query: 11 LEPRVRELDRAKHITE*RSQ-------QQERVVPDTPGERLVRHPQREQRPLLQEV 157 L PR+R R + TE RSQ ++++ P+TP E + ++Q+P++ + Sbjct: 228 LPPRMRLPSRLQTSTEDRSQGLMPVIPDRQQITPNTPNEGRTQQKNQQQKPVVMSL 283
>E74EF_DROVI (Q7M3M6) Ecdysone-induced protein 74EF (ETS-related protein E74A)| Length = 873 Score = 29.3 bits (64), Expect = 5.3 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +3 Query: 15 NLASGNWIEPNILQNNAASN-RSAWFQIHQVNDSFAIRSVSS 137 +L +G ++ PN+ QNNAA++ R+ W + V D++ S SS Sbjct: 527 HLHTGTFLHPNLYQNNAANSLRNIWNRSVGVPDNYYGNSGSS 568
>MURC_CAUCR (Q9A5A6) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 473 Score = 28.5 bits (62), Expect = 9.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 171 FTSCLNAADTTITAEARVVVEEPI 242 F+SC N ADT I A+ E+PI Sbjct: 383 FSSCFNDADTVIVADVYTAGEQPI 406
>IL12B_PAPAN (Q865Y3) Interleukin-12 beta chain precursor (IL-12B) (IL-12 p40)| (Cytotoxic lymphocyte maturation factor 40 kDa subunit) (CLMF p40) Length = 328 Score = 28.5 bits (62), Expect = 9.1 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -1 Query: 187 LRQLVKPDPVNLLQKRPLLTLRMANESFTW-CIWNHALLLLAALFC 53 +R ++KPDP LQ +PL R A S+ + W+ + FC Sbjct: 229 IRDIIKPDPPKNLQLKPLKNSRQAEVSWEYPDTWSTPHSYFSLTFC 274
>YJF8_YEAST (P47041) Hypothetical 60.8 kDa protein in BTN1-PEP8 intergenic| region Length = 543 Score = 28.5 bits (62), Expect = 9.1 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 117 AIRSVSSGRFCKRFTGSGFTSCLNAADTTITAE-ARVVVEEPILHREIHS 263 ++ S SGR+ K SGF + N A TTI+++ A + + LH HS Sbjct: 149 SLHSTPSGRYMKG-KASGFFNRRNRAHTTISSDPASFLTDSSTLHNSSHS 197 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,197,804 Number of Sequences: 219361 Number of extensions: 741583 Number of successful extensions: 2621 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2618 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)