| Clone Name | baet102c07 |
|---|---|
| Clone Library Name | barley_pub |
>MINC_PSEPK (Q88M41) Probable septum site-determining protein minC| Length = 250 Score = 30.4 bits (67), Expect = 3.1 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 5/67 (7%) Frame = -1 Query: 202 GSQQRPLTRDA-----PPPHSRQPPAK*EHPCASALRTNQVLRGGKELAAAGGDDAASMR 38 G+++RPL + P P PP + + T+ V RGG+++ A GGD + Sbjct: 111 GARERPLEPEPEVVKKPEPAPAPPPPPEPEVRPTRIITSPV-RGGQQIYAQGGDLVVTAS 169 Query: 37 ESPGLSL 17 SPG L Sbjct: 170 VSPGAEL 176
>NOTC1_RAT (Q07008) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 30.4 bits (67), Expect = 3.1 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 146 WLPRVRRGGIPGQWSLLAPGIS 211 WLPR++ G +P Q++ L PG++ Sbjct: 2300 WLPRLQNGMVPSQYNPLRPGVT 2321
>NOTC1_MOUSE (Q01705) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| (Motch A) (mT14) (p300) [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 30.4 bits (67), Expect = 3.1 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 146 WLPRVRRGGIPGQWSLLAPGIS 211 WLPR++ G +P Q++ L PG++ Sbjct: 2300 WLPRLQNGMVPSQYNPLRPGVT 2321
>PPDK_GIALA (P51776) Pyruvate, phosphate dikinase (EC 2.7.9.1) (Pyruvate,| orthophosphate dikinase) Length = 884 Score = 29.6 bits (65), Expect = 5.3 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -1 Query: 337 AEPVGRLERHVHQRVEELHQ 278 AE + + RH+H+RVE+LH+ Sbjct: 647 AEDMNKKHRHIHERVEDLHE 666
>MNTH_STAES (Q8CPM6) Probable manganese transport protein mntH| Length = 453 Score = 29.3 bits (64), Expect = 6.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 74 QFFTTTQNLVCPQSTRTWMLLLSWWLPRVRRG 169 Q T+ QNL+ P +TW+ ++SW L V G Sbjct: 409 QLATSNQNLMGPFKNKTWINIISWLLIIVLSG 440
>MNTH_STAEQ (Q5HQ64) Probable manganese transport protein mntH| Length = 453 Score = 29.3 bits (64), Expect = 6.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 74 QFFTTTQNLVCPQSTRTWMLLLSWWLPRVRRG 169 Q T+ QNL+ P +TW+ ++SW L V G Sbjct: 409 QLATSNQNLMGPFKNKTWINIISWLLIIVLSG 440
>MINC_PSEAE (Q9HYZ7) Probable septum site-determining protein minC| Length = 263 Score = 29.3 bits (64), Expect = 6.9 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 17/79 (21%) Frame = -1 Query: 202 GSQQRPLT---------RDAPPP---HSRQPPAK*EH-PCASALRTNQVL----RGGKEL 74 G+++RPL + P P +R PAK E P R +V+ RGG ++ Sbjct: 111 GARERPLDIKDSAPRKPAEEPSPSAGEARPEPAKAEEKPAEPVSRPTKVVKTPVRGGMQI 170 Query: 73 AAAGGDDAASMRESPGLSL 17 AAGGD SPG L Sbjct: 171 YAAGGDLIVLAAVSPGAEL 189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,639,919 Number of Sequences: 219361 Number of extensions: 812053 Number of successful extensions: 2612 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2604 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)