ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet101h03 |
|---|---|
| Clone Library Name | barley_pub |
>CLPP2_SYNEL (Q8DJZ9) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 198 Score = 87.0 bits (214), Expect = 2e-17 Identities = 37/58 (63%), Positives = 47/58 (81%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MP+G P+VPYR PGE QW+DI+N LYRERIIF+G +D+E +NQ++A MLYLDS D Sbjct: 1 MPIGVPKVPYRLPGEPYTQWIDIYNRLYRERIIFLGKEVDDEIANQIVAVMLYLDSED 58
>CLPP_ARATH (P56772) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 80.1 bits (196), Expect = 2e-15 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+VP+R+PGEG W+DI+N LYRER+ F+G +D E SNQ+++ M+YL DT Sbjct: 1 MPIGVPKVPFRSPGEGDTSWVDIYNRLYRERLFFLGQEVDTEISNQLISLMIYLSIEKDT 60
>CLPP_SPIOL (Q9M3K5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 79.3 bits (194), Expect = 4e-15 Identities = 31/60 (51%), Positives = 45/60 (75%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+VP+R+PGE W+D++N LYRER++F+G +D E SNQ++ M+YL DDT Sbjct: 1 MPIGVPKVPFRSPGEEDASWVDVYNRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDDT 60
>CLPP3_ANASP (Q8YP43) Probable ATP-dependent Clp protease proteolytic subunit 3| (EC 3.4.21.92) (Endopeptidase Clp 3) Length = 197 Score = 78.6 bits (192), Expect = 7e-15 Identities = 33/58 (56%), Positives = 45/58 (77%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MP+G P+VPYR PG W+ I++ LYRERIIF+G ++D+E +NQ++A MLYLDS D Sbjct: 1 MPIGVPKVPYRMPGGQFTDWISIYDRLYRERIIFLGRDVDDEIANQIIAVMLYLDSED 58
>CLPP_TOBAC (P12210) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 77.8 bits (190), Expect = 1e-14 Identities = 30/60 (50%), Positives = 45/60 (75%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+VP+R+PGE W+D++N LYRER++F+G +D E SNQ++ M+YL D+T Sbjct: 1 MPIGVPKVPFRSPGEEDASWVDVYNRLYRERLLFLGQEVDSEISNQLIGLMVYLSIEDET 60
>CLPP_ANTFO (Q85BZ1) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 204 Score = 76.6 bits (187), Expect = 2e-14 Identities = 28/60 (46%), Positives = 47/60 (78%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+VP+R PGE W+D++N LYRER++F+G ++D+E +NQ++ M+YL+ D++ Sbjct: 1 MPIGVPKVPFRLPGEEDAVWIDVYNRLYRERLLFLGQHVDDEIANQLIGIMMYLNGEDES 60
>CLPP_MARPO (P12208) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 203 Score = 76.3 bits (186), Expect = 3e-14 Identities = 28/60 (46%), Positives = 46/60 (76%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+VP+R PGE W+D++N LYRER++F+G +D+E +NQ++ M+YL+ D++ Sbjct: 1 MPIGVPKVPFRLPGEEDAVWIDVYNRLYRERLLFLGQQVDDEIANQLIGIMMYLNGEDES 60
>CLPP_ADICA (Q85FJ8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 76.3 bits (186), Expect = 3e-14 Identities = 29/58 (50%), Positives = 45/58 (77%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MP+G P+VP+R PGE W+D++N LYRER++F+G +D+E +NQ++ M+YL+S D Sbjct: 1 MPIGVPKVPFRLPGEEDAVWVDVYNRLYRERLLFLGQQVDDEIANQLIGIMMYLNSED 58
>CLPP_CHAGL (Q8M9Y9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 76.3 bits (186), Expect = 3e-14 Identities = 31/58 (53%), Positives = 44/58 (75%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MPVG P+VPYR PG+ QW+D++N LYRERI+F+G ++ E +NQ++ MLYL+ D Sbjct: 1 MPVGVPKVPYRLPGDVQVQWIDLYNRLYRERILFLGQTVNYEIANQIIGLMLYLNGDD 58
>CLPP_LOTJA (Q9BBQ9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 75.9 bits (185), Expect = 4e-14 Identities = 30/59 (50%), Positives = 44/59 (74%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDD 436 MP+G P+VP+R+PGE W+DI+N LYRER++F+G ++ E SNQ++ M+YL DD Sbjct: 1 MPIGVPKVPFRSPGEEDASWVDIYNRLYRERLLFLGQEVNSEISNQLIGLMVYLSIEDD 59
>CLPP_EPIVI (P30063) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 75.9 bits (185), Expect = 4e-14 Identities = 29/60 (48%), Positives = 44/60 (73%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+VP++ PGE W+D++N LYRER++F+G +D + SNQ++ M+YL DDT Sbjct: 1 MPIGVPKVPFQIPGEEDASWVDVYNRLYRERLLFLGQEVDSDISNQLIGLMVYLSIEDDT 60
>CLPP_MESVI (Q9MUV8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 229 Score = 75.9 bits (185), Expect = 4e-14 Identities = 30/60 (50%), Positives = 48/60 (80%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+V YR PGE ++D++N LYRERI+F+G+++D+E +NQ++ M++L+S DDT Sbjct: 1 MPIGIPKVAYRIPGEAVSTYVDVYNRLYRERILFLGEDLDDEVANQLIGVMVFLNSEDDT 60
>CLPP_CALFE (Q7YJV2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 202 Score = 75.9 bits (185), Expect = 4e-14 Identities = 30/60 (50%), Positives = 45/60 (75%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+VP+R+PGE W+D++N L+RER++F+G +D E SNQ++ M+YL DDT Sbjct: 1 MPIGVPKVPFRSPGEEDAVWVDVYNRLHRERLLFLGQEVDSEISNQLVGLMVYLTIEDDT 60
>CLPP_AMBTC (Q70XY2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 202 Score = 75.9 bits (185), Expect = 4e-14 Identities = 31/60 (51%), Positives = 45/60 (75%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MPVG P+VP+R+PGE W+DI+N L+RER++F+G ++ E SNQ++ M+YL DDT Sbjct: 1 MPVGVPKVPFRSPGEEDATWVDIYNRLHRERLLFLGQEVEGEISNQIVGLMVYLSIEDDT 60
>CLPP_PANGI (Q68RY2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 75.5 bits (184), Expect = 6e-14 Identities = 31/60 (51%), Positives = 44/60 (73%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+VP+R+PGE W+DI+N LYRER++F+G + E SNQ++ M+YL DDT Sbjct: 1 MPIGVPKVPFRSPGEEDAYWVDIYNRLYRERLLFLGQPVASEISNQLIGLMVYLSIEDDT 60
>CLPP_GLOVI (Q7NEW2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 197 Score = 75.5 bits (184), Expect = 6e-14 Identities = 34/58 (58%), Positives = 45/58 (77%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MP+G P+VPYR PG G QW+DI+N L +RIIF+G +D+E +N ++ASMLYLDS D Sbjct: 1 MPIGIPKVPYRLPG-GQSQWIDIFNRLALDRIIFLGREVDDEIANAIIASMLYLDSED 57
>CLPP_PSINU (Q8WHZ7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 198 Score = 75.5 bits (184), Expect = 6e-14 Identities = 28/59 (47%), Positives = 45/59 (76%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDD 436 MP+G P+VP+R PGE W+D++N LYRER++F+G +D+E +NQ++ M+YL+ D+ Sbjct: 1 MPIGVPKVPFRLPGEEDAGWVDVYNRLYRERLLFLGQQVDDEIANQLIGIMMYLNGEDE 59
>CLPP_NYMAL (Q6EW27) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 202 Score = 75.1 bits (183), Expect = 7e-14 Identities = 30/60 (50%), Positives = 45/60 (75%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+VP+R+PGE W+DI+N L+RER++F+G +D E SNQ++ M+YL D+T Sbjct: 1 MPIGVPKVPFRSPGEEDAVWVDIYNRLHRERLLFLGQGVDSEISNQLVGLMVYLSMEDNT 60
>CLPP_NEPOL (Q9TL09) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 208 Score = 73.9 bits (180), Expect = 2e-13 Identities = 30/58 (51%), Positives = 43/58 (74%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MPVG P+VPYR PGE QW+D++N LYR+R++F+G + +E SNQ+ M+YL + D Sbjct: 1 MPVGVPKVPYRLPGESAPQWVDLYNRLYRQRLLFMGQELGDELSNQLCGIMIYLFAED 58
>CLPP_CHLVU (P56317) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 73.9 bits (180), Expect = 2e-13 Identities = 28/56 (50%), Positives = 45/56 (80%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 MP+G P+VP+R PGE + QW+D++N LYRER++F+ +D+E +NQ++ MLYL++ Sbjct: 1 MPIGVPKVPFRLPGEPSAQWVDLYNRLYRERVLFLCQELDDELANQLIGIMLYLNA 56
>CLPP_HUPLU (Q5SD28) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 209 Score = 72.4 bits (176), Expect = 5e-13 Identities = 26/60 (43%), Positives = 45/60 (75%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+VP+R PG+ W+D++N L+RER++F+G +D+E +NQ++ M+Y + DD+ Sbjct: 1 MPIGVPKVPFRLPGDEDAVWIDVYNRLFRERLLFLGQQVDDELANQLICIMIYPNGEDDS 60
>CLPP_PHYPA (Q6YXM7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 71.6 bits (174), Expect = 8e-13 Identities = 28/60 (46%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWN-ALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDD 436 MP+G P+VP+R PGE W+D++N LYRER++F+G ++D+E +NQ++ M+YL+ D+ Sbjct: 1 MPIGVPKVPFRLPGEEDAVWIDVYNNRLYRERLLFLGQHVDDEIANQLIGIMMYLNGEDE 60
>CLPP3_SYNP7 (Q9L4P3) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 199 Score = 70.1 bits (170), Expect = 2e-12 Identities = 29/60 (48%), Positives = 41/60 (68%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P VPYR PG +W+DI+N L ERIIF+G + + +N ++A +LYLDS D + Sbjct: 1 MPIGVPSVPYRLPGSSFERWIDIYNRLAMERIIFLGQEVTDGLANSIVAQLLYLDSEDSS 60
>CLPP2_SYNP6 (Q5N1Q7) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 199 Score = 70.1 bits (170), Expect = 2e-12 Identities = 29/60 (48%), Positives = 41/60 (68%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P VPYR PG +W+DI+N L ERIIF+G + + +N ++A +LYLDS D + Sbjct: 1 MPIGVPSVPYRLPGSSFERWIDIYNRLAMERIIFLGQEVTDGLANSIVAQLLYLDSEDSS 60
>CLPP_PINTH (P41609) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 69.7 bits (169), Expect = 3e-12 Identities = 27/58 (46%), Positives = 43/58 (74%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MPVG P+VP+R PG+ W+D++N LYRER++F+ +I+ E +NQ++ M+YL + D Sbjct: 1 MPVGVPKVPFRAPGDEDATWVDLYNRLYRERLLFLAQDINHEIANQLMGLMVYLSAED 58
>CLPP_PINKO (Q85X43) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 69.7 bits (169), Expect = 3e-12 Identities = 27/58 (46%), Positives = 43/58 (74%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MPVG P+VP+R PG+ W+D++N LYRER++F+ +I+ E +NQ++ M+YL + D Sbjct: 1 MPVGVPKVPFRAPGDEDATWVDLYNRLYRERLLFLAQDINHEIANQLMGLMVYLSAED 58
>CLPP_PINCO (P36387) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 205 Score = 69.7 bits (169), Expect = 3e-12 Identities = 27/58 (46%), Positives = 43/58 (74%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MPVG P+VP+R PG+ W+D++N LYRER++F+ +I+ E +NQ++ M+YL + D Sbjct: 1 MPVGVPKVPFRAPGDEDATWVDLYNRLYRERLLFLAQDINNEIANQLMGLMVYLSAED 58
>CLPP2_PROMP (Q7V0F1) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 201 Score = 69.3 bits (168), Expect = 4e-12 Identities = 30/60 (50%), Positives = 43/60 (71%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+GTP VPYR PG +W+DI+ L ERI+F+G +++ +N ++A MLYLDS D+T Sbjct: 1 MPIGTPSVPYRLPGSQYERWVDIYTRLGVERILFLGQEVNDGIANSLVAQMLYLDSDDNT 60
>CLPP2_PROMM (Q7V8M4) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 200 Score = 68.9 bits (167), Expect = 5e-12 Identities = 30/60 (50%), Positives = 41/60 (68%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+GTP VPYR PG +W+DI+ L ERI+F+G + + +N ++A MLYLDS D T Sbjct: 1 MPIGTPSVPYRLPGSQMERWVDIYTRLGVERILFLGQEVSDGVANSLVAQMLYLDSEDST 60
>CLPP2_PROMA (Q7VAR9) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 200 Score = 68.9 bits (167), Expect = 5e-12 Identities = 30/60 (50%), Positives = 41/60 (68%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+GTP VPYR PG +W+DI+ L ERI+F+G + + +N ++A MLYLDS D T Sbjct: 1 MPIGTPSVPYRLPGSQFERWVDIYTRLGAERILFLGQEVTDGVANSLVAQMLYLDSEDST 60
>CLPP2_PROMT (Q46JF7) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 200 Score = 68.6 bits (166), Expect = 7e-12 Identities = 29/60 (48%), Positives = 42/60 (70%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+GTP VPYR PG +W+DI+ L ERI+F+G +++ +N ++A MLYLDS D + Sbjct: 1 MPIGTPSVPYRLPGSQFERWVDIYTRLGAERILFLGQEVNDGIANSLVAQMLYLDSEDSS 60
>CLPP3_SYNPX (Q7U5Q2) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 200 Score = 68.2 bits (165), Expect = 9e-12 Identities = 29/60 (48%), Positives = 42/60 (70%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+GTP VPYR PG +W+DI+ L ERI+F+G +++ +N ++A MLYLDS D + Sbjct: 1 MPIGTPSVPYRLPGSQMERWVDIYTRLGVERILFLGSEVNDGIANSLVAQMLYLDSEDSS 60
>CLPP_ACOGR (Q5QA83) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 202 Score = 67.4 bits (163), Expect = 2e-11 Identities = 28/60 (46%), Positives = 42/60 (70%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 MP+G P+V + +PGE W+DI+N L+RER++F+G +D E SNQ++ M+YL D T Sbjct: 1 MPIGVPKVLFGSPGEEDAAWVDIYNRLHRERLLFLGQELDSEISNQLVGLMVYLSIEDKT 60
>CLPP3_SYNY3 (P74467) Probable ATP-dependent Clp protease proteolytic subunit 3| (EC 3.4.21.92) (Endopeptidase Clp 3) Length = 202 Score = 66.6 bits (161), Expect = 3e-11 Identities = 27/58 (46%), Positives = 42/58 (72%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MP+G P VP+R PG +W+DI+ L +ERIIF+G +++ +N+++A +LYLDS D Sbjct: 1 MPIGVPSVPFRLPGSQYERWIDIYTRLSQERIIFLGQEVNDSIANRIVAFLLYLDSDD 58
>CLPP_SYNP8 (Q93AD7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 66.2 bits (160), Expect = 3e-11 Identities = 28/58 (48%), Positives = 41/58 (70%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MP+G P VPYR PG +W+DI+ L +ERIIF+G + + +N+++A +LYLDS D Sbjct: 1 MPLGVPSVPYRLPGSQYERWIDIYTRLSQERIIFLGQEVTDGLANRIVAFLLYLDSED 58
>CLPP_WHEAT (P24064) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 65.1 bits (157), Expect = 7e-11 Identities = 27/59 (45%), Positives = 41/59 (69%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDD 436 MP+G P+VPYR PG+ W+D++N +YRER +F+G I E +N + M+YL S++D Sbjct: 1 MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEITNHITGLMVYL-SIED 58
>CLPP_SACOF (Q6ENT9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 65.1 bits (157), Expect = 7e-11 Identities = 27/59 (45%), Positives = 41/59 (69%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDD 436 MP+G P+VPYR PG+ W+D++N +YRER +F+G I E +N + M+YL S++D Sbjct: 1 MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEITNHITGLMVYL-SIED 58
>CLPP_SACHY (Q6L377) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 65.1 bits (157), Expect = 7e-11 Identities = 27/59 (45%), Positives = 41/59 (69%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDD 436 MP+G P+VPYR PG+ W+D++N +YRER +F+G I E +N + M+YL S++D Sbjct: 1 MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEITNHITGLMVYL-SIED 58
>CLPP_MAIZE (P26567) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 65.1 bits (157), Expect = 7e-11 Identities = 27/59 (45%), Positives = 41/59 (69%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDD 436 MP+G P+VPYR PG+ W+D++N +YRER +F+G I E +N + M+YL S++D Sbjct: 1 MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEITNHITGLMVYL-SIED 58
>CLPP_ORYSA (P12209) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 64.7 bits (156), Expect = 1e-10 Identities = 27/59 (45%), Positives = 41/59 (69%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDD 436 MP+G P+VPYR PG+ W+D++N +YRER +F+G I E +N + M+YL S++D Sbjct: 1 MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEVTNHITGLMVYL-SIED 58
>CLPP_ORYNI (Q6ENE9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 64.7 bits (156), Expect = 1e-10 Identities = 27/59 (45%), Positives = 41/59 (69%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDD 436 MP+G P+VPYR PG+ W+D++N +YRER +F+G I E +N + M+YL S++D Sbjct: 1 MPIGVPKVPYRIPGDEEATWVDLYNVMYRERTLFLGQEIRCEVTNHITGLMVYL-SIED 58
>CLPP_OENHO (Q9MTJ8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 249 Score = 52.0 bits (123), Expect = 7e-07 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 6/66 (9%) Frame = +2 Query: 260 MPVGTPRVPYRTPG------EGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYL 421 MP+G P++P+ G E W+D++N LYR R IF+GD I E +N + M++L Sbjct: 1 MPIGMPKIPFLLDGDEEDEEEDDATWVDLYNVLYRTRSIFLGDAIHFEVANHIAGLMIFL 60 Query: 422 DSVDDT 439 D T Sbjct: 61 TIQDAT 66
>CLPP_CHLEU (P42379) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) [Contains: Ceu clpP intein (Insertion IS2)] Length = 1010 Score = 47.8 bits (112), Expect = 1e-05 Identities = 20/58 (34%), Positives = 34/58 (58%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MP+G PR+ Y E QW DI+N ++R R++F+ +D+E NQ+ ++ + D Sbjct: 1 MPIGVPRIIYCWGEELPAQWTDIYNFIFRRRMVFLMQYLDDELCNQICGLLINIHMED 58
>CLPP_CHLRE (P42380) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 524 Score = 47.8 bits (112), Expect = 1e-05 Identities = 20/58 (34%), Positives = 34/58 (58%) Frame = +2 Query: 260 MPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 MP+G PR+ Y E QW DI+N ++R R++F+ +D+E NQ+ ++ + D Sbjct: 1 MPIGVPRIIYCWGEELPAQWTDIYNFIFRRRMVFLMQYLDDELCNQICGLLINIHMED 58
>CLPP2_COREF (Q8FN36) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 199 Score = 46.6 bits (109), Expect = 3e-05 Identities = 22/48 (45%), Positives = 32/48 (66%) Frame = +2 Query: 296 PGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 PG GT DI++ L RERIIF+G +D+E +N++ A +L L + D T Sbjct: 10 PGAGTGYSGDIFDRLLRERIIFLGSQVDDEIANKLCAQILLLSAEDPT 57
>CLPP2_RHOBA (Q7UK66) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 195 Score = 43.1 bits (100), Expect = 3e-04 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = +2 Query: 275 PRVPYRTPGEGTWQ-WLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 P +PY G + DI++ L ++RIIF+G +D++ SN ++A ML+L + D Sbjct: 2 PVIPYVVESNGREERTYDIYSRLLKDRIIFLGQQVDDQISNALVAQMLFLQADD 55
>CLPP_BACFR (Q64NW2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 220 Score = 42.4 bits (98), Expect = 5e-04 Identities = 19/38 (50%), Positives = 28/38 (73%) Frame = +2 Query: 320 LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 LD+++ L +RIIF+G ID+ +N + A +LYLDSVD Sbjct: 45 LDVFSRLMMDRIIFLGTQIDDYTANTLQAQLLYLDSVD 82
>CLPP_CARHZ (Q3AF96) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 42.4 bits (98), Expect = 5e-04 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DIW+ L ++R IFIG ID+ +N V+A ML+L++ D Sbjct: 20 DIWSRLLKDRTIFIGGPIDDHVANLVIAQMLFLEAED 56
>CLPP_BACFN (Q5L8L6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 42.4 bits (98), Expect = 5e-04 Identities = 19/38 (50%), Positives = 28/38 (73%) Frame = +2 Query: 320 LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 LD+++ L +RIIF+G ID+ +N + A +LYLDSVD Sbjct: 32 LDVFSRLMMDRIIFLGTQIDDYTANTLQAQLLYLDSVD 69
>CLPP_FUSNN (Q8RHJ8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 42.0 bits (97), Expect = 7e-04 Identities = 17/37 (45%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RIIF+G IDE +N ++A +LYL++ D Sbjct: 18 DIYSRLLKDRIIFVGTAIDETVANSIIAQLLYLEAED 54
>CLPP1_ANASP (Q8YXH5) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 204 Score = 42.0 bits (97), Expect = 7e-04 Identities = 16/37 (43%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERI+F+G +D +N ++A +L+LD+ D Sbjct: 18 DIYSRLLRERIVFLGQQVDSNLANLIVAQLLFLDAED 54
>CLPP_BACTN (Q8A129) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 220 Score = 42.0 bits (97), Expect = 7e-04 Identities = 18/38 (47%), Positives = 28/38 (73%) Frame = +2 Query: 320 LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 LD+++ L +RIIF+G +D+ +N + A +LYLDSVD Sbjct: 45 LDVFSRLMMDRIIFLGTQVDDYTANTLQAQLLYLDSVD 82
>CLPP2_ANASP (Q8YQX8) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 232 Score = 42.0 bits (97), Expect = 7e-04 Identities = 18/37 (48%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G ID+ +N ++A +L+LD+ D Sbjct: 45 DIYSRLLRERIIFLGTPIDDAVANTIVAQLLFLDAED 81
>CLPP2_STRAW (Q82NZ3) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 200 Score = 41.6 bits (96), Expect = 9e-04 Identities = 23/54 (42%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = +2 Query: 275 PRVPYRTP-GEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 P V RTP GE ++ D+++ L ERIIF+G ID+ +N V+A +L+L+S + Sbjct: 7 PNVVERTPQGERSY---DVFSRLLSERIIFLGTEIDDGVANVVIAQLLHLESAN 57
>CLPP4_STRCO (Q9X7S0) Putative ATP-dependent Clp protease proteolytic| subunit-like (Endopeptidase Clp-like) Length = 200 Score = 41.2 bits (95), Expect = 0.001 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +2 Query: 275 PRVPYRTP-GEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 P V RTP GE ++ D+++ L ERIIF+G ID+ +N V+A +L+L+S Sbjct: 7 PNVVERTPQGERSY---DVFSRLLSERIIFLGTEIDDGVANVVIAQLLHLES 55
>CLPP2_SYNY3 (Q59993) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 226 Score = 41.2 bits (95), Expect = 0.001 Identities = 16/37 (43%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G +D++ ++ ++A +L+LD+ D Sbjct: 39 DIYSRLLRERIIFLGTPVDDQVADSIVAQLLFLDAED 75
>CLPP_CHLCH (Q3ATL3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 225 Score = 40.8 bits (94), Expect = 0.002 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +2 Query: 293 TPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 T G G + DI++ L RERIIF+G IDE + ++A +++L+S D Sbjct: 35 TSGRGE-RAFDIFSRLLRERIIFLGTGIDEHVAGLIMAQLIFLESED 80
>CLPP_PELCD (Q3A3X5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 40.8 bits (94), Expect = 0.002 Identities = 16/37 (43%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RIIF+G +D++ +N ++A ML+L+S D Sbjct: 19 DIFSRLLKDRIIFLGGAVDDQVANLIIAQMLFLESED 55
>CLPP_DESPS (Q6AK59) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 203 Score = 40.8 bits (94), Expect = 0.002 Identities = 20/54 (37%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +2 Query: 275 PRVPYRTP-GEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 P V +TP GE ++ DI++ L +ERIIF+G ++++ +N ++A +L+L++ D Sbjct: 5 PMVVEQTPRGERSY---DIYSRLLKERIIFLGSGVNDDVANVIVAQLLFLEAED 55
>CLPP_DEHSC (Q3ZX82) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 40.8 bits (94), Expect = 0.002 Identities = 17/37 (45%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L +ERIIF+G I+++ +N V+A +L+LD D Sbjct: 23 DIYSLLLKERIIFLGSQINDQVANLVIAQLLFLDRED 59
>CLPP_DEHE1 (Q3Z8J8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 40.8 bits (94), Expect = 0.002 Identities = 17/37 (45%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L +ERIIF+G I+++ +N V+A +L+LD D Sbjct: 23 DIYSLLLKERIIFLGSQINDQVANLVIAQLLFLDRED 59
>CLPP2_SYMTH (Q67QZ4) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 200 Score = 40.8 bits (94), Expect = 0.002 Identities = 17/37 (45%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RIIF+G +ID++ +N V A +L+L+S D Sbjct: 20 DIYSRLLKDRIIFLGTSIDDQVANAVTAQLLFLESDD 56
>CLPP1_PROMP (Q7V1W0) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 196 Score = 40.8 bits (94), Expect = 0.002 Identities = 16/43 (37%), Positives = 32/43 (74%) Frame = +2 Query: 305 GTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 G+ + DI++ L RERIIF+G+ + + +N+++A +L+L++ D Sbjct: 11 GSERVFDIYSRLLRERIIFLGEQVTSDTANRIVAQLLFLEAED 53
>CLPP_PORGI (Q7MX09) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 222 Score = 40.4 bits (93), Expect = 0.002 Identities = 17/38 (44%), Positives = 27/38 (71%) Frame = +2 Query: 320 LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 +D+++ L +RIIF+G ID+ +N + A +LYLDS D Sbjct: 45 MDVFSRLMMDRIIFLGTQIDDYTANVIQAQLLYLDSAD 82
>CLPP1_BACSK (Q5WLZ7) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 40.4 bits (93), Expect = 0.002 Identities = 18/37 (48%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RIIFIGD I + +N V A +L+L S D Sbjct: 20 DIYSRLLKDRIIFIGDEITDTLANSVTAQLLFLASTD 56
>CLPP1_PROMM (Q7V992) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 224 Score = 40.4 bits (93), Expect = 0.002 Identities = 16/37 (43%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G +D++ ++ ++A ML+L++ D Sbjct: 41 DIYSRLLRERIIFLGTGVDDQVADALVAQMLFLEAED 77
>CLPP_CHLTE (Q8KC73) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 225 Score = 40.4 bits (93), Expect = 0.002 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +2 Query: 293 TPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 T G G + DI++ L RERIIF+G IDE + ++A +++L+S D Sbjct: 35 TSGRGE-RAFDIFSRLLRERIIFLGSPIDEHVAGLIIAQLIFLESED 80
>CLPP1_SYMTH (Q67SK0) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 202 Score = 40.4 bits (93), Expect = 0.002 Identities = 16/37 (43%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RI+F+G ID++ +N V+A +L+L+S D Sbjct: 20 DIYSRLLKDRIVFLGTPIDDQVANVVIAQLLFLESED 56
>CLPP3_PROMM (Q7V7R2) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 197 Score = 40.4 bits (93), Expect = 0.002 Identities = 16/37 (43%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G+ + + +N+++A ML+L++ D Sbjct: 17 DIYSRLLRERIIFLGEPVTSDSANRIVAQMLFLEAED 53
>CLPP2_SYNPX (Q7U6N7) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 197 Score = 40.4 bits (93), Expect = 0.002 Identities = 16/37 (43%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G+ + + +N+++A ML+L++ D Sbjct: 17 DIYSRLLRERIIFLGEAVTSDSANRIVAQMLFLEAED 53
>CLPP1_SYNP7 (P54415) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 197 Score = 39.7 bits (91), Expect = 0.003 Identities = 15/37 (40%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G+ + + +N+++A +L+L++ D Sbjct: 17 DIYSRLLRERIIFLGEPVTSDVANRIVAQLLFLEAED 53
>CLPP1_SYNP6 (Q5N665) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 197 Score = 39.7 bits (91), Expect = 0.003 Identities = 15/37 (40%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G+ + + +N+++A +L+L++ D Sbjct: 17 DIYSRLLRERIIFLGEPVTSDVANRIVAQLLFLEAED 53
>CLPP1_SYNY3 (P54416) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 198 Score = 39.7 bits (91), Expect = 0.003 Identities = 19/47 (40%), Positives = 32/47 (68%) Frame = +2 Query: 293 TPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 T G G + DI++ L RERI+F+G + +E +N V+A +L+L++ D Sbjct: 8 TSGRGD-RAFDIYSRLLRERIVFLGQEVRDENANLVVAQLLFLEAED 53
>CLPP_GEOSL (Q74C82) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 39.7 bits (91), Expect = 0.003 Identities = 16/37 (43%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RIIF+G +D+ +N V+A ML+L++ D Sbjct: 18 DIYSRLLKDRIIFLGGPVDDHVANLVIAQMLFLEAED 54
>CLPP1_PROMA (Q7VC22) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 196 Score = 39.7 bits (91), Expect = 0.003 Identities = 14/37 (37%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERI+F+G+ + + +N+++A +L+L++ D Sbjct: 17 DIYSRLLRERIVFLGEQVTNDSANRIVAQLLFLEAED 53
>CLPP_PASMU (Q9CJM2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 39.3 bits (90), Expect = 0.004 Identities = 14/37 (37%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L +ER+IF+G +++ +N ++A +L+L+S D Sbjct: 19 DIYSRLLKERVIFLGGEVEDRMANLIVAQLLFLESED 55
>CLPP3_PROMP (Q7UZK7) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 215 Score = 39.3 bits (90), Expect = 0.004 Identities = 16/37 (43%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G I+++ S+ ++A +L+L++ D Sbjct: 40 DIYSRLLRERIIFLGTGINDQVSDSLVAQLLFLEAED 76
>CLPP3_SYNP6 (Q5N1P6) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 240 Score = 39.3 bits (90), Expect = 0.004 Identities = 23/79 (29%), Positives = 45/79 (56%), Gaps = 1/79 (1%) Frame = +2 Query: 200 NRRVSLGLSNKRATRARISMMPVGTPRVPYRTPGEGTWQW-LDIWNALYRERIIFIGDNI 376 +RR++ GL + R + +I + VP G + DI++ L RERI+F+G + Sbjct: 12 SRRLAAGLDS-RWQQPQIQAIAGSQAIVPTVVEQSGRGERAFDIYSRLLRERIVFLGTGV 70 Query: 377 DEEFSNQVLASMLYLDSVD 433 D+ ++ ++A +L+L++ D Sbjct: 71 DDAVADSIVAQLLFLEAED 89
>CLPP2_SYNP7 (O34125) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 240 Score = 39.3 bits (90), Expect = 0.004 Identities = 23/79 (29%), Positives = 45/79 (56%), Gaps = 1/79 (1%) Frame = +2 Query: 200 NRRVSLGLSNKRATRARISMMPVGTPRVPYRTPGEGTWQW-LDIWNALYRERIIFIGDNI 376 +RR++ GL + R + +I + VP G + DI++ L RERI+F+G + Sbjct: 12 SRRLAAGLDS-RWQQPQIQAIAGSQAIVPTVVEQSGRGERAFDIYSRLLRERIVFLGTGV 70 Query: 377 DEEFSNQVLASMLYLDSVD 433 D+ ++ ++A +L+L++ D Sbjct: 71 DDAVADSIVAQLLFLEAED 89
>CLPP1_CORJK (Q4JWV4) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 188 Score = 39.3 bits (90), Expect = 0.004 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +2 Query: 326 IWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 ++ L RERIIF+G +D+E +N++ A +L L + D T Sbjct: 12 VYERLLRERIIFLGSQVDDEIANELCAQILLLSAEDPT 49
>CLPP2_CORGL (Q8NN01) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 201 Score = 39.3 bits (90), Expect = 0.004 Identities = 19/48 (39%), Positives = 30/48 (62%) Frame = +2 Query: 296 PGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 PG G D+++ L ERIIF+G +D+E +N++ A +L L + D T Sbjct: 16 PGFGN----DVFDRLLSERIIFLGSQVDDEIANKLCAQILLLSAEDPT 59
>CLPP1_SYNPX (Q7UA36) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 224 Score = 39.3 bits (90), Expect = 0.004 Identities = 16/37 (43%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G +D+ ++ ++A ML+L++ D Sbjct: 41 DIYSRLLRERIIFLGTGVDDAVADALVAQMLFLEAED 77
>CLPP2_CHLTR (O84712) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 39.3 bits (90), Expect = 0.004 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +2 Query: 281 VPYRTPGEGTWQW-LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 VPY G + +DI++ L ++RI+ IG I E +N V+A +L+L S D T Sbjct: 4 VPYVVEDTGRGERAMDIYSRLLKDRIVMIGQEITEPLANTVIAQLLFLMSEDPT 57
>CLPP2_CHLTA (Q3KKY8) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 39.3 bits (90), Expect = 0.004 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +2 Query: 281 VPYRTPGEGTWQW-LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 VPY G + +DI++ L ++RI+ IG I E +N V+A +L+L S D T Sbjct: 4 VPYVVEDTGRGERAMDIYSRLLKDRIVMIGQEITEPLANTVIAQLLFLMSEDPT 57
>CLPP2_CHLMU (Q9PLM0) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 39.3 bits (90), Expect = 0.004 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +2 Query: 281 VPYRTPGEGTWQW-LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 VPY G + +DI++ L ++RI+ IG I E +N V+A +L+L S D T Sbjct: 4 VPYVVEDTGRGERAMDIYSRLLKDRIVMIGQEITEPLANTVIAQLLFLMSEDPT 57
>CLPP3_PROMA (Q7V9L6) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 216 Score = 39.3 bits (90), Expect = 0.004 Identities = 15/37 (40%), Positives = 30/37 (81%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G +++++ ++ ++A ML+L++ D Sbjct: 41 DIYSRLLRERIIFLGTDVNDQIADALVAQMLFLEAED 77
>CLPP1_MYCPA (Q73XM9) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 211 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/35 (42%), Positives = 26/35 (74%) Frame = +2 Query: 329 WNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 +N L+ ERIIF+G +D+ +N ++A +L L+S+D Sbjct: 30 YNKLFEERIIFLGVQVDDASANDIMAQLLVLESLD 64
>CLPP_GEOMG (Q39UH2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 38.9 bits (89), Expect = 0.006 Identities = 16/37 (43%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RIIF+G ID+ +N V+A +L+L++ D Sbjct: 18 DIYSRLLKDRIIFLGGPIDDHVANLVIAQLLFLEAED 54
>CLPP3_NOCFA (Q5Z062) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 221 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/35 (42%), Positives = 26/35 (74%) Frame = +2 Query: 329 WNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 +N L+ ERIIF+G +D+ +N ++A +L L+S+D Sbjct: 41 YNKLFEERIIFLGVQVDDASANDIMAQLLVLESLD 75
>CLPP_OCEIH (Q8ENM5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/37 (40%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ SN ++A +L+L++ D Sbjct: 19 DIYSRLLKDRIILLGSGIDDNVSNSIVAQLLFLEAED 55
>CLPP2_MYCTU (P63783) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 214 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/35 (42%), Positives = 26/35 (74%) Frame = +2 Query: 329 WNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 +N L+ ERIIF+G +D+ +N ++A +L L+S+D Sbjct: 33 YNKLFEERIIFLGVQVDDASANDIMAQLLVLESLD 67
>CLPP2_MYCLE (Q9CBY4) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 214 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/35 (42%), Positives = 26/35 (74%) Frame = +2 Query: 329 WNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 +N L+ ERIIF+G +D+ +N ++A +L L+S+D Sbjct: 33 YNKLFEERIIFLGVQVDDASANDIMAQLLVLESLD 67
>CLPP2_MYCBO (P63784) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 214 Score = 38.9 bits (89), Expect = 0.006 Identities = 15/35 (42%), Positives = 26/35 (74%) Frame = +2 Query: 329 WNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 +N L+ ERIIF+G +D+ +N ++A +L L+S+D Sbjct: 33 YNKLFEERIIFLGVQVDDASANDIMAQLLVLESLD 67
>CLPP_HAEIN (P43867) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 38.5 bits (88), Expect = 0.007 Identities = 14/39 (35%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L +ER+IF+ +++ +N ++A +L+L+S D T Sbjct: 19 DIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPT 57
>CLPP_HAEI8 (Q4QMK5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 38.5 bits (88), Expect = 0.007 Identities = 14/39 (35%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L +ER+IF+ +++ +N ++A +L+L+S D T Sbjct: 19 DIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPT 57
>CLPP1_THEFY (Q47MU3) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 222 Score = 38.5 bits (88), Expect = 0.007 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = +2 Query: 329 WNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 +N L+ ERIIF+G ID+ +N ++A M+ L+ +D Sbjct: 44 YNKLFEERIIFVGVQIDDTSANDIIAQMMTLEHID 78
>CLPP1_PROMT (Q46L44) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 196 Score = 38.5 bits (88), Expect = 0.007 Identities = 14/37 (37%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERI+F+G+ + + +N+++A +L+L++ D Sbjct: 17 DIYSRLLRERIVFLGEPVTSDSANRIVAQLLFLEADD 53
>CLPP_PSEHT (Q3IF46) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 205 Score = 38.5 bits (88), Expect = 0.007 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +2 Query: 275 PRVPYRTP-GEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 P V +TP GE ++ DI++ L +ERIIF+ +++ +N +LA ML+L+S Sbjct: 14 PMVVEQTPKGERSY---DIYSRLLKERIIFLTGPVEDNMANLILAQMLFLES 62
>CLPP2_CORDI (Q6NFU4) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 199 Score = 38.5 bits (88), Expect = 0.007 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +2 Query: 326 IWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 ++ L RERIIF+G +D+E +N++ A +L L + D T Sbjct: 20 VYERLLRERIIFLGTQVDDEIANKLCAQILLLSAEDPT 57
>CLPP_LACJO (Q74K84) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 38.5 bits (88), Expect = 0.007 Identities = 14/39 (35%), Positives = 29/39 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + I+++ +N ++A +L+LD+ D+T Sbjct: 18 DIYSRLLKDRIIMLSGEINDQMANSIIAQLLFLDAQDNT 56
>CLPP_LACAC (Q5FL55) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 38.5 bits (88), Expect = 0.007 Identities = 14/39 (35%), Positives = 29/39 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + I+++ +N ++A +L+LD+ D+T Sbjct: 18 DIYSRLLKDRIIMLSGEINDQMANSIIAQLLFLDAQDNT 56
>CLPP3_PROMT (Q46ID4) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 194 Score = 38.5 bits (88), Expect = 0.007 Identities = 15/37 (40%), Positives = 30/37 (81%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G +++++ ++ ++A ML+L++ D Sbjct: 17 DIYSRLLRERIIFLGTDVNDQVADALVAQMLFLEADD 53
>CLPP_THET8 (Q5SKM8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 38.1 bits (87), Expect = 0.010 Identities = 16/35 (45%), Positives = 27/35 (77%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L ++RIIF+G ID + +N V+A +L+LD+ Sbjct: 18 DIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDA 52
>CLPP_THET2 (Q72L15) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 38.1 bits (87), Expect = 0.010 Identities = 16/35 (45%), Positives = 27/35 (77%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L ++RIIF+G ID + +N V+A +L+LD+ Sbjct: 18 DIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDA 52
>CLPP_THETN (Q8RC25) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 38.1 bits (87), Expect = 0.010 Identities = 15/37 (40%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RI+F+GD I++ ++ V+A ML+L++ D Sbjct: 19 DIFSRLLKDRIVFLGDEINDTTASLVIAQMLFLEAED 55
>CLPP2_CORJK (Q4JWV3) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 209 Score = 38.1 bits (87), Expect = 0.010 Identities = 14/35 (40%), Positives = 25/35 (71%) Frame = +2 Query: 329 WNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 +N L+ ERIIF+G +D+ +N ++A +L L+ +D Sbjct: 30 YNKLFEERIIFLGTQVDDASANDIMAQLLVLEGLD 64
>CLPP2_BACHD (Q9K888) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 194 Score = 37.7 bits (86), Expect = 0.013 Identities = 13/35 (37%), Positives = 28/35 (80%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L ++RI+F+G ID++ +N ++A +L+L++ Sbjct: 20 DIYSRLLKDRIVFLGAAIDDQIANSIVAQLLFLEA 54
>CLPP4_STRAW (Q82CA5) ATP-dependent Clp protease proteolytic subunit 4 (EC| 3.4.21.92) (Endopeptidase Clp 4) Length = 226 Score = 37.7 bits (86), Expect = 0.013 Identities = 21/53 (39%), Positives = 34/53 (64%) Frame = +2 Query: 275 PRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 PR RT +G ++ D + L+ ER+IF+G ID+ +N V+A +L L+S+D Sbjct: 29 PRFVERT-SQGVREY-DPYAKLFEERVIFLGVQIDDASANDVMAQLLCLESMD 79
>CLPP2_CHLAB (Q5L4W7) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 205 Score = 37.7 bits (86), Expect = 0.013 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +2 Query: 281 VPYRTPGEGTWQW-LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 VPY G + +DI++ L ++RI+ IG I E +N V+A +L+L S D Sbjct: 6 VPYVVEDTGRGERAMDIYSRLLKDRIVMIGQEITEPLANTVIAQLLFLMSED 57
>CLPP2_STRCO (Q9ZH58) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 218 Score = 37.7 bits (86), Expect = 0.013 Identities = 21/53 (39%), Positives = 34/53 (64%) Frame = +2 Query: 275 PRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 PR RT +G ++ D + L+ ER+IF+G ID+ +N V+A +L L+S+D Sbjct: 21 PRFVERT-SQGVREY-DPYAKLFEERVIFLGVQIDDASANDVMAQLLCLESMD 71
>CLPP_THEMA (Q9WZF9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 203 Score = 37.7 bits (86), Expect = 0.013 Identities = 15/37 (40%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RI+F+G ID+ +N V+A +L+L++ D Sbjct: 28 DIFSRLLKDRIVFLGSPIDDYVANLVIAQLLFLEAED 64
>CLPP2_CHLPN (Q9Z759) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 37.7 bits (86), Expect = 0.013 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +2 Query: 281 VPYRTPGEGTWQW-LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 VPY G + +DI++ L ++RI+ IG I E +N V+A +L+L S D Sbjct: 4 VPYVVEDTGRGERAMDIYSRLLKDRIVMIGQEITEPLANTVIAQLLFLMSED 55
>CLPP2_CHLCV (Q821M0) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 37.7 bits (86), Expect = 0.013 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +2 Query: 281 VPYRTPGEGTWQW-LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 VPY G + +DI++ L ++RI+ IG I E +N V+A +L+L S D Sbjct: 4 VPYVVEDTGRGERAMDIYSRLLKDRIVMIGQEITEPLANTVIAQLLFLMSED 55
>CLPP2_BACSK (Q5WDK0) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 195 Score = 37.7 bits (86), Expect = 0.013 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G +D+ +N ++A ML+L + D Sbjct: 19 DIYSRLLKDRIIMLGSGVDDNVANSIVAQMLFLQAED 55
>CLPP_DEIRA (Q9RSZ7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 204 Score = 37.4 bits (85), Expect = 0.017 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L ++RIIF+G ++ + +N ++A +L LDS Sbjct: 22 DIYSRLLKDRIIFVGTPVESQMANSIVAQLLLLDS 56
>CLPP2_NOCFA (Q5Z063) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 37.4 bits (85), Expect = 0.017 Identities = 15/38 (39%), Positives = 26/38 (68%) Frame = +2 Query: 326 IWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 ++ L RERIIF+G +D++ +N++ A +L L + D T Sbjct: 22 VYERLLRERIIFLGTQVDDDIANKLCAQILLLSAEDPT 59
>CLPP_LISMO (Q9RQI6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 198 Score = 37.4 bits (85), Expect = 0.017 Identities = 14/37 (37%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+LD+ D Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQD 55
>CLPP_LISMF (Q71WV9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 198 Score = 37.4 bits (85), Expect = 0.017 Identities = 14/37 (37%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+LD+ D Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQD 55
>CLPP_LISIN (Q928C4) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 198 Score = 37.4 bits (85), Expect = 0.017 Identities = 14/37 (37%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+LD+ D Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQD 55
>CLPP_WIGBR (Q8D346) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 37.0 bits (84), Expect = 0.022 Identities = 15/37 (40%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L +ERIIF+ I++ +N ++A M++L+S D Sbjct: 19 DIFSRLLKERIIFVTGKIEDYMANLIIAQMIFLESED 55
>CLPP_AQUAE (O67357) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 37.0 bits (84), Expect = 0.022 Identities = 20/54 (37%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = +2 Query: 275 PRVPYRTP-GEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 P V +TP GE + DI++ L ++RI+ +G ID+ +N ++A +L+L+S D Sbjct: 12 PIVIEQTPRGERAY---DIYSRLLQDRIVLLGSPIDDHVANLIVAQLLFLESQD 62
>CLPP2_BACHK (Q6HBD8) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 193 Score = 37.0 bits (84), Expect = 0.022 Identities = 14/37 (37%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L+S D Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQD 55
>CLPP2_BACCZ (Q631K2) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 193 Score = 37.0 bits (84), Expect = 0.022 Identities = 14/37 (37%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L+S D Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQD 55
>CLPP2_BACCR (Q815J6) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 193 Score = 37.0 bits (84), Expect = 0.022 Identities = 14/37 (37%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L+S D Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQD 55
>CLPP2_BACC1 (Q72XW9) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 193 Score = 37.0 bits (84), Expect = 0.022 Identities = 14/37 (37%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L+S D Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQD 55
>CLPP2_BACAN (Q81X63) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 193 Score = 37.0 bits (84), Expect = 0.022 Identities = 14/37 (37%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L+S D Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQD 55
>CLPP2_PARUW (Q6MBE9) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 207 Score = 37.0 bits (84), Expect = 0.022 Identities = 16/38 (42%), Positives = 27/38 (71%) Frame = +2 Query: 320 LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 +DI++ L ++RIIFIG I ++ +N V+A +L+L D Sbjct: 28 MDIYSRLLKDRIIFIGTEITDQVANVVVAQLLFLKMED 65
>CLPP_STRA5 (Q8DYA5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 37.0 bits (84), Expect = 0.022 Identities = 13/39 (33%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N ++A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGQVEDNMANSIIAQLLFLDAQDNT 55
>CLPP_STRA3 (Q8E3X0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 37.0 bits (84), Expect = 0.022 Identities = 13/39 (33%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N ++A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGQVEDNMANSIIAQLLFLDAQDNT 55
>CLPP_STRA1 (Q3JZV0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 37.0 bits (84), Expect = 0.022 Identities = 13/39 (33%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N ++A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGQVEDNMANSIIAQLLFLDAQDNT 55
>CLPP_GEOKA (Q5KVD9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 37.0 bits (84), Expect = 0.022 Identities = 13/37 (35%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RI+F+G ID++ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIVFLGSPIDDQVANSIVSQLLFLAAED 55
>CLPP_STRT2 (Q5M5U4) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 36.6 bits (83), Expect = 0.028 Identities = 14/39 (35%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + I++ +N ++A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGPIEDNMANSIIAQLLFLDAQDNT 55
>CLPP_STRT1 (Q5M1A8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 36.6 bits (83), Expect = 0.028 Identities = 14/39 (35%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + I++ +N ++A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGPIEDNMANSIIAQLLFLDAQDNT 55
>CLPP_STRPM (Q48V25) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 36.6 bits (83), Expect = 0.028 Identities = 14/39 (35%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N V+A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDNT 55
>CLPP_STRP8 (P69886) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 36.6 bits (83), Expect = 0.028 Identities = 14/39 (35%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N V+A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDNT 55
>CLPP_STRP6 (Q5XDM4) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 36.6 bits (83), Expect = 0.028 Identities = 14/39 (35%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N V+A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDNT 55
>CLPP_STRP3 (P69885) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 36.6 bits (83), Expect = 0.028 Identities = 14/39 (35%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N V+A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDNT 55
>CLPP_STRP1 (P69884) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 36.6 bits (83), Expect = 0.028 Identities = 14/39 (35%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N V+A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDNT 55
>CLPP_FRATT (Q5NH47) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 36.6 bits (83), Expect = 0.028 Identities = 14/37 (37%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L +ERI+F+ +++ +N V+A +L+L+S D Sbjct: 22 DIYSRLLKERIVFLNGEVNDHSANLVIAQLLFLESED 58
>CLPP_LEPIN (Q8F352) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 198 Score = 36.6 bits (83), Expect = 0.028 Identities = 13/35 (37%), Positives = 29/35 (82%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L ++RIIF+G+ I+++++N + A +L+L++ Sbjct: 19 DIFSRLLKDRIIFLGNAINDDYANVITAQLLFLEA 53
>CLPP_ENTFA (Q837R0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 197 Score = 36.6 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII + ID+ +N V+A +L+LD+ D Sbjct: 19 DIYSRLLKDRIIMLSGPIDDNVANSVIAQLLFLDAQD 55
>CLPP1_LEPIC (Q72SG6) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 198 Score = 36.6 bits (83), Expect = 0.028 Identities = 13/35 (37%), Positives = 29/35 (82%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L ++RIIF+G+ I+++++N + A +L+L++ Sbjct: 19 DIFSRLLKDRIIFLGNAINDDYANVITAQLLFLEA 53
>CLPP1_BORBU (O51556) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 197 Score = 36.6 bits (83), Expect = 0.028 Identities = 16/39 (41%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L RERIIF+ I++ ++ V+A +L+L+S D + Sbjct: 23 DIYSRLLRERIIFLSGEINDPKADTVIAQLLFLESEDSS 61
>CLPP_HAEDU (Q7VP78) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 197 Score = 36.2 bits (82), Expect = 0.037 Identities = 13/37 (35%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L +ERIIF+ +++ +N ++A +L+L++ D Sbjct: 19 DIYSRLLKERIIFLNGEVEDHMANLIVAQLLFLEAED 55
>CLPP_BUCBP (Q89AA1) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 205 Score = 36.2 bits (82), Expect = 0.037 Identities = 15/35 (42%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ ID+ +N ++A ML+L++ Sbjct: 30 DIYSRLLKERIIFLTGTIDDNTANLIVAQMLFLEA 64
>CLPP2_MYXXA (Q9X5N0) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 206 Score = 36.2 bits (82), Expect = 0.037 Identities = 14/37 (37%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI + L ++RI+ +G ID++ +N ++A +L+L+S D Sbjct: 21 DIISRLLKDRIVMLGTEIDDDVANVIVAQLLFLESED 57
>CLPP_CLOAB (P58276) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 36.2 bits (82), Expect = 0.037 Identities = 13/37 (35%), Positives = 29/37 (78%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++R+IF+G+ +++ ++ V+A +L+L+S D Sbjct: 19 DIYSRLLKDRVIFLGEEVNDTTASLVVAQLLFLESED 55
>CLPP_STRSL (P36398) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 36.2 bits (82), Expect = 0.037 Identities = 13/39 (33%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N ++A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDNT 55
>CLPP_STRR6 (P63788) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 36.2 bits (82), Expect = 0.037 Identities = 14/39 (35%), Positives = 27/39 (69%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N V+A +L+LD+ D T Sbjct: 17 DIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDST 55
>CLPP_STRPN (P63787) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 36.2 bits (82), Expect = 0.037 Identities = 14/39 (35%), Positives = 27/39 (69%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N V+A +L+LD+ D T Sbjct: 17 DIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDST 55
>CLPP_STRMU (Q8DST7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 36.2 bits (82), Expect = 0.037 Identities = 13/39 (33%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N ++A +L+LD+ D+T Sbjct: 17 DIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDNT 55
>CLPP1_BIFLO (Q8G5R0) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 233 Score = 35.8 bits (81), Expect = 0.049 Identities = 18/59 (30%), Positives = 33/59 (55%) Frame = +2 Query: 257 MMPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 +MP + PY + D ++ L+ +RIIF+G +D+ ++ V+A +L L+S D Sbjct: 41 IMPQFVEKTPYGMKTQ------DAYSRLFEDRIIFLGVQVDDASADDVMAQLLVLESQD 93
>CLPP1_BACCZ (Q63AG0) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 35.8 bits (81), Expect = 0.049 Identities = 14/37 (37%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII IG I+++ ++ V+A +L+L++ D Sbjct: 19 DIYSRLLKDRIIIIGSEINDQVASSVVAQLLFLEAED 55
>CLPP1_BACCR (Q81CH1) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 35.8 bits (81), Expect = 0.049 Identities = 14/37 (37%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII IG I+++ ++ V+A +L+L++ D Sbjct: 19 DIYSRLLKDRIIIIGSEINDQVASSVVAQLLFLEAED 55
>CLPP1_BACC1 (Q736T1) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 35.8 bits (81), Expect = 0.049 Identities = 14/37 (37%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII IG I+++ ++ V+A +L+L++ D Sbjct: 19 DIYSRLLKDRIIIIGSEINDQVASSVVAQLLFLEAED 55
>CLPP_VIBF1 (Q5E6Q5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.8 bits (81), Expect = 0.049 Identities = 20/59 (33%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = +2 Query: 254 SMMPVGTPRVPYRTP-GEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 S+M P V +T GE ++ DI++ L +ER+IF+ +++ +N V+A +L+L+S Sbjct: 11 SIMDALVPMVVEQTSRGERSY---DIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLES 66
>CLPP3_STRAW (Q82CA6) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 219 Score = 35.8 bits (81), Expect = 0.049 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +2 Query: 326 IWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDD 436 ++N L ERIIF+G +D++ +N++ A +L L S D Sbjct: 35 VYNRLLGERIIFLGQAVDDDIANKITAQLLLLASDPD 71
>CLPP1_STRCO (Q9F315) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 219 Score = 35.8 bits (81), Expect = 0.049 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +2 Query: 326 IWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDD 436 ++N L ERIIF+G +D++ +N++ A +L L S D Sbjct: 36 VYNRLLGERIIFLGQPVDDDIANKITAQLLLLASDPD 72
>CLPP_CHRVO (Q7NUY9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 210 Score = 35.8 bits (81), Expect = 0.049 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +2 Query: 257 MMPVGTPRVPYRTPGEGTWQWL-DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 M P G VP G + DI++ L +ERI+F+ + +E +N V+A ML+L+S Sbjct: 5 MEPQGLGLVPMVVEQSGRGERAYDIYSRLLKERIVFLVGPVTDESANLVVAQMLFLES 62
>CLPP1_METCA (Q60C68) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 206 Score = 35.8 bits (81), Expect = 0.049 Identities = 21/64 (32%), Positives = 38/64 (59%) Frame = +2 Query: 236 ATRARISMMPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASML 415 ATRA ++PV + GE + DI++ L +ER+IF+ +++ +N V+A +L Sbjct: 4 ATRAAGGLVPVV---IEQSARGERAF---DIYSRLLKERVIFLVGQVEDYMANLVIAQLL 57 Query: 416 YLDS 427 +L+S Sbjct: 58 FLES 61
>CLPP_STAAW (P63786) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 35.8 bits (81), Expect = 0.049 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQD 55
>CLPP_STAAS (Q6GB62) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 35.8 bits (81), Expect = 0.049 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQD 55
>CLPP_STAAR (Q6GIM3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 35.8 bits (81), Expect = 0.049 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQD 55
>CLPP_STAAN (P99089) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 35.8 bits (81), Expect = 0.049 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQD 55
>CLPP_STAAM (P63785) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 35.8 bits (81), Expect = 0.049 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQD 55
>CLPP_STAAC (Q5HHQ0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 35.8 bits (81), Expect = 0.049 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQD 55
>CLPP_STAAB (Q2YSF8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 35.8 bits (81), Expect = 0.049 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQD 55
>CLPP_SHEON (Q8EG19) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 202 Score = 35.8 bits (81), Expect = 0.049 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ ++E +N ++A +L+L+S Sbjct: 27 DIYSRLLKERIIFLVGQVEEHMANLIVAQLLFLES 61
>CLPP1_BACLD (Q65EI5) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 198 Score = 35.8 bits (81), Expect = 0.049 Identities = 13/37 (35%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L++ D Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAED 55
>CLPP_STAS1 (Q49VZ2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 35.8 bits (81), Expect = 0.049 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQD 55
>CLPP_STAES (Q8CTE0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 35.8 bits (81), Expect = 0.049 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQD 55
>CLPP_STAEQ (Q5HQW0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 35.8 bits (81), Expect = 0.049 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQD 55
>CLPP1_BACHD (Q9K709) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 194 Score = 35.8 bits (81), Expect = 0.049 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N ++A +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGTAIDDNVANSIVAQLLFLQAED 55
>CLPP_NITEU (Q82Y57) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 214 Score = 35.4 bits (80), Expect = 0.063 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +2 Query: 242 RARISMMPVGTPRVPY--RTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASML 415 R R + G +P T G G + DI++ L RERIIF+ + E +N V+A +L Sbjct: 7 RERNGLDTTGLGLIPMVIETSGRGERAY-DIYSRLLRERIIFLVGPVTETSANLVIAQLL 65 Query: 416 YLDS 427 +L+S Sbjct: 66 FLES 69
>CLPP_MANSM (Q65RF6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 193 Score = 35.4 bits (80), Expect = 0.063 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A +L+L+S Sbjct: 19 DIYSRLLKERVIFLSGEVEDNMANLIVAQLLFLES 53
>CLPP1_CORDI (Q6NFU5) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 209 Score = 35.4 bits (80), Expect = 0.063 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = +2 Query: 338 LYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 L+ ERIIF+G +D+ +N ++A +L L+ +D Sbjct: 35 LFEERIIFLGTQVDDTSANDIMAQLLVLEGLD 66
>CLPP1_BACHK (Q6HHU9) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 35.4 bits (80), Expect = 0.063 Identities = 13/37 (35%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RI+ IG I+++ ++ V+A +L+L++ D Sbjct: 19 DIYSRLLKDRIVIIGSEINDQVASSVVAQLLFLEAED 55
>CLPP1_BACAN (Q81PL4) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 193 Score = 35.4 bits (80), Expect = 0.063 Identities = 13/37 (35%), Positives = 28/37 (75%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RI+ IG I+++ ++ V+A +L+L++ D Sbjct: 19 DIYSRLLKDRIVIIGSEINDQVASSVVAQLLFLEAED 55
>CLPP1_CORGL (Q8NN02) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 208 Score = 35.4 bits (80), Expect = 0.063 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = +2 Query: 338 LYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 L+ ERIIF+G +D+ +N ++A +L L+ +D Sbjct: 34 LFEERIIFLGTQVDDTSANDIMAQLLVLEGMD 65
>CLPP1_COREF (Q8FN37) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 208 Score = 35.4 bits (80), Expect = 0.063 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = +2 Query: 338 LYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 L+ ERIIF+G +D+ +N ++A +L L+ +D Sbjct: 34 LFEERIIFLGTQVDDTSANDIMAQLLVLEGMD 65
>CLPP_PHOLL (Q7N0L3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.4 bits (80), Expect = 0.063 Identities = 18/49 (36%), Positives = 31/49 (63%) Frame = +2 Query: 281 VPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 V T GE ++ DI++ L +ERIIF+ +++ +N V A ML+L++ Sbjct: 21 VEQTTRGERSY---DIYSRLLKERIIFLTGQVEDHMANLVAAQMLFLEA 66
>CLPP_BURP1 (Q3JRC9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.4 bits (80), Expect = 0.063 Identities = 17/54 (31%), Positives = 34/54 (62%) Frame = +2 Query: 266 VGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 +G + T G G + DI++ L +ERI+F+ ++++ +N V+A +L+L+S Sbjct: 14 LGLVPIVVETSGRGERSY-DIYSRLLKERIVFMVGEVNDQTANLVVAQLLFLES 66
>CLPP_BURMA (Q62JK7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 35.4 bits (80), Expect = 0.063 Identities = 17/54 (31%), Positives = 34/54 (62%) Frame = +2 Query: 266 VGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 +G + T G G + DI++ L +ERI+F+ ++++ +N V+A +L+L+S Sbjct: 14 LGLVPIVVETSGRGERSY-DIYSRLLKERIVFMVGEVNDQTANLVVAQLLFLES 66
>CLPP1_GLUOX (Q5FUR3) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 215 Score = 35.4 bits (80), Expect = 0.063 Identities = 16/39 (41%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L +ERIIF+ + ++ S+ + A +LYL+SV+ T Sbjct: 32 DIFSRLLQERIIFLTGPVYDQVSSLICAQLLYLESVNPT 70
>CLPP_COLP3 (Q47XL8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 220 Score = 35.4 bits (80), Expect = 0.063 Identities = 21/76 (27%), Positives = 43/76 (56%) Frame = +2 Query: 200 NRRVSLGLSNKRATRARISMMPVGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNID 379 ++R S S AT +++P+ V GE ++ DI++ L +ER+IF+ ++ Sbjct: 8 SQRSSQVSSQSSATGIESALVPMV---VEQTAKGERSY---DIYSRLLKERVIFLCGQVE 61 Query: 380 EEFSNQVLASMLYLDS 427 + +N ++A +L+L+S Sbjct: 62 DHMANLIIAQLLFLES 77
>CLPP_LACLC (Q9ZAB0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 35.4 bits (80), Expect = 0.063 Identities = 13/39 (33%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N ++A +L+LD+ D+T Sbjct: 20 DIYSRLLKDRIIMLTGPVEDGMANSIIAQLLFLDAQDNT 58
>CLPP_LACLA (Q9CHQ3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 35.4 bits (80), Expect = 0.063 Identities = 13/39 (33%), Positives = 28/39 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 DI++ L ++RII + +++ +N ++A +L+LD+ D+T Sbjct: 20 DIYSRLLKDRIIMLTGPVEDGMANSIIAQLLFLDAQDNT 58
>CLPP2_MYCPA (Q73XM8) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 199 Score = 35.4 bits (80), Expect = 0.063 Identities = 16/50 (32%), Positives = 30/50 (60%) Frame = +2 Query: 290 RTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVDDT 439 R+P +G ++ L ERIIF+G ++++ +N++ A +L L + D T Sbjct: 5 RSPSQGLNLTDSVYERLLSERIIFLGSEVNDDVANRLCAQILLLAAEDPT 54
>CLPP_BURPS (Q63V41) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 35.4 bits (80), Expect = 0.063 Identities = 17/54 (31%), Positives = 34/54 (62%) Frame = +2 Query: 266 VGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 +G + T G G + DI++ L +ERI+F+ ++++ +N V+A +L+L+S Sbjct: 24 LGLVPIVVETSGRGERSY-DIYSRLLKERIVFMVGEVNDQTANLVVAQLLFLES 76
>CLPP_ACIAD (Q6FEP8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 35.4 bits (80), Expect = 0.063 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L RER+IF+ +++ +N ++A ML+L++ Sbjct: 26 DIFSRLLRERVIFLTGEVEDNMANLIVAQMLFLEA 60
>CLPP_LACSS (Q38Y96) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 35.4 bits (80), Expect = 0.063 Identities = 12/37 (32%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII + ++++ +N ++A +L+LD+ D Sbjct: 18 DIYSRLLKDRIIMLSGEVNDQMANTIIAQLLFLDAQD 54
>CLPP_BORGA (Q660R2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 194 Score = 35.4 bits (80), Expect = 0.063 Identities = 16/37 (43%), Positives = 27/37 (72%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+ I++ ++ V+A +L+L+S D Sbjct: 20 DIYSRLLRERIIFLSGEINDLKADTVIAQLLFLESED 56
>CLPP5_STRCO (Q9FCC9) Putative ATP-dependent Clp protease proteolytic| subunit-like (Endopeptidase Clp-like) Length = 211 Score = 35.0 bits (79), Expect = 0.083 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLD 424 D ++ L +ERI+F+G +DE +N V A ++YL+ Sbjct: 25 DPYSKLLQERIVFLGTPVDETSANDVTAQLMYLE 58
>CLPP_BUCAP (Q8K990) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 197 Score = 35.0 bits (79), Expect = 0.083 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIFI I++ ++ ++A ML+L++ Sbjct: 23 DIYSRLLKERIIFITGTIEDNMASSIVAQMLFLEA 57
>CLPP_PHOPR (Q6LNW0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 199 Score = 35.0 bits (79), Expect = 0.083 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N V+A +L+L+S Sbjct: 24 DIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLES 58
>CLPP_VIBVY (Q7MMG7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 35.0 bits (79), Expect = 0.083 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N V+A +L+L+S Sbjct: 24 DIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLES 58
>CLPP_VIBVU (Q8DG26) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 35.0 bits (79), Expect = 0.083 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N V+A +L+L+S Sbjct: 24 DIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLES 58
>CLPP_VIBPA (Q87R80) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 35.0 bits (79), Expect = 0.083 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N V+A +L+L+S Sbjct: 24 DIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLES 58
>CLPP_VIBCH (Q9KQS6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 35.0 bits (79), Expect = 0.083 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N V+A +L+L+S Sbjct: 24 DIYSRLLKERVIFLTGQVEDHMANLVVAQLLFLES 58
>CLPP_STAHJ (Q4L4J5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 195 Score = 35.0 bits (79), Expect = 0.083 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLQAQD 55
>CLPP_BDEBA (Q6MH11) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 212 Score = 35.0 bits (79), Expect = 0.083 Identities = 13/34 (38%), Positives = 25/34 (73%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLD 424 DI++ L ++RII +G + +E +N ++A ML+L+ Sbjct: 30 DIYSRLLKDRIIILGTAVTDEVANSIIAQMLFLE 63
>CLPP1_PROAC (Q6A7F0) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 216 Score = 35.0 bits (79), Expect = 0.083 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +2 Query: 320 LDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 +D + L+ +RIIF+G + ++ +N V+A +L L S+D Sbjct: 39 VDPYTKLFEDRIIFLGTPVTDDIANAVMAQLLCLQSMD 76
>CLPP_LEGPL (Q5WVJ0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 214 Score = 34.7 bits (78), Expect = 0.11 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ +++ +N V+A +L+L+S Sbjct: 31 DIYSRLLKERIIFLLGEVEDHMANLVVAQLLFLES 65
>CLPP_LEGPH (Q5ZUD9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 214 Score = 34.7 bits (78), Expect = 0.11 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ +++ +N V+A +L+L+S Sbjct: 31 DIYSRLLKERIIFLLGEVEDHMANLVVAQLLFLES 65
>CLPP_LEGPA (Q5X451) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 214 Score = 34.7 bits (78), Expect = 0.11 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ +++ +N V+A +L+L+S Sbjct: 31 DIYSRLLKERIIFLLGEVEDHMANLVVAQLLFLES 65
>CLPP_RICFE (Q4ULF0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 34.7 bits (78), Expect = 0.11 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ +++ +N V+A +L+L++ Sbjct: 19 DIYSRLLKERIIFVCSTVEDHMANLVVAQLLFLEA 53
>CLPP_BUCAI (P57547) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 208 Score = 34.7 bits (78), Expect = 0.11 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIFI I++ +N ++A +L+L++ Sbjct: 33 DIYSRLLKERIIFITGAIEDNMANNIVAQILFLEA 67
>CLPP_BLOPB (Q493F8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 208 Score = 34.7 bits (78), Expect = 0.11 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ I++ +N ++A M++L+S Sbjct: 33 DIFSLLLKERIIFMTGTIEDSVANLIVAQMMFLES 67
>CLPP2_THEFY (Q47MU2) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 203 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/32 (37%), Positives = 23/32 (71%) Frame = +2 Query: 338 LYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 L R+RI+F+G +D+E +N+++ +L L + D Sbjct: 26 LLRQRIVFLGQQVDDEIANRIVGELLLLSAED 57
>CLPP1_SYNEL (Q8DLI2) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 229 Score = 34.7 bits (78), Expect = 0.11 Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 6/43 (13%) Frame = +2 Query: 323 DIWNALYRERIIFIGD------NIDEEFSNQVLASMLYLDSVD 433 DI++ L RERIIF+G ID+ ++ ++A +L+LD+ D Sbjct: 44 DIYSRLLRERIIFLGGGAGDRRGIDDAVADSIVAQLLFLDAED 86
>CLPP_SHISS (Q3Z4W6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A ML+L++ Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEA 66
>CLPP_SHIFL (P0A6H0) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A ML+L++ Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEA 66
>CLPP_SHIDS (Q32JJ3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A ML+L++ Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEA 66
>CLPP_SHIBS (Q325G4) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A ML+L++ Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEA 66
>CLPP_SALTY (P0A1D7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A ML+L++ Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEA 66
>CLPP_SALTI (P0A1D8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A ML+L++ Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEA 66
>CLPP_SALPA (Q5PFN4) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A ML+L++ Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEA 66
>CLPP_SALCH (Q57SB5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A ML+L++ Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEA 66
>CLPP_ERWCT (Q6D827) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ +++ +N V+A ML+L++ Sbjct: 32 DIYSRLLKERIIFLTGQVEDYMANLVVAQMLFLEA 66
>CLPP_ECOLI (P0A6G7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) (Caseinolytic protease) (Protease Ti) (Heat shock protein F21.5) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A ML+L++ Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEA 66
>CLPP_ECOL6 (P0A6G8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A ML+L++ Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEA 66
>CLPP_ECO57 (P0A6G9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 34.7 bits (78), Expect = 0.11 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N ++A ML+L++ Sbjct: 32 DIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEA 66
>CLPP_BURS3 (Q39FE8) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 34.7 bits (78), Expect = 0.11 Identities = 16/54 (29%), Positives = 34/54 (62%) Frame = +2 Query: 266 VGTPRVPYRTPGEGTWQWLDIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 +G + T G G + DI++ L +ER++F+ ++++ +N V+A +L+L+S Sbjct: 24 LGLVPIVVETSGRGERSY-DIYSRLLKERLVFMVGEVNDQTANLVVAQLLFLES 76
>CLPP_BORPE (Q7VXI7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 34.7 bits (78), Expect = 0.11 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +2 Query: 254 SMMPVGTPRVPYRTPGEGTWQWL-DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 S+ P G +P G + DI++ L RER+IF+ +++ +N V+A +L+L+S Sbjct: 16 SVTPTGLGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDNTANLVVAQLLFLES 74
>CLPP_BORPA (Q7W8X2) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 34.7 bits (78), Expect = 0.11 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +2 Query: 254 SMMPVGTPRVPYRTPGEGTWQWL-DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 S+ P G +P G + DI++ L RER+IF+ +++ +N V+A +L+L+S Sbjct: 16 SVTPTGLGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDNTANLVVAQLLFLES 74
>CLPP_BORBR (Q7WK83) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 34.7 bits (78), Expect = 0.11 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +2 Query: 254 SMMPVGTPRVPYRTPGEGTWQWL-DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 S+ P G +P G + DI++ L RER+IF+ +++ +N V+A +L+L+S Sbjct: 16 SVTPTGLGYIPMVIEQSGRGERAYDIYSRLLRERLIFLVGPVNDNTANLVVAQLLFLES 74
>CLPP_LACPL (Q88YH9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 196 Score = 34.7 bits (78), Expect = 0.11 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII + I++ +N ++A +L+LD+ D Sbjct: 19 DIYSRLLKDRIIMLSGPIEDNMANAIIAQLLFLDAQD 55
>CLPP_PSYAR (Q4FQB9) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 225 Score = 34.3 bits (77), Expect = 0.14 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L RER+IF+ +++ +N ++A +L+L++ Sbjct: 47 DIFSRLLRERVIFLTGQVEDHMANLIVAQLLFLEA 81
>CLPP1_AGRT5 (Q8UEX6) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 202 Score = 34.3 bits (77), Expect = 0.14 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L RERIIF+ +D+ S V A +L+L++ Sbjct: 23 DIYSRLLRERIIFLNGEVDDTVSALVCAQLLFLEA 57
>CLPP_BACSU (P80244) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) (Caseinolytic protease) (Stress protein G7) Length = 197 Score = 34.3 bits (77), Expect = 0.14 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDSVD 433 DI++ L ++RII +G ID+ +N +++ +L+L + D Sbjct: 19 DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAED 55
>CLPP_RICTY (Q68WL5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 34.3 bits (77), Expect = 0.14 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ +++ +N ++A +L+L++ Sbjct: 19 DIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEA 53
>CLPP_RICPR (Q9ZD29) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 34.3 bits (77), Expect = 0.14 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ +++ +N ++A +L+L++ Sbjct: 19 DIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEA 53
>CLPP_RICCN (Q92HM5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 201 Score = 34.3 bits (77), Expect = 0.14 Identities = 12/35 (34%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ +++ +N ++A +L+L++ Sbjct: 19 DIYSRLLKERIIFVCSTVEDHMANLIVAQLLFLEA 53
>CLPP_AZOSE (Q5P161) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 212 Score = 34.3 bits (77), Expect = 0.14 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = +2 Query: 227 NKRATRARISMMPVGTPRVPYRTPGEGTWQWL-DIWNALYRERIIFIGDNIDEEFSNQVL 403 N A + PVG VP G + DI++ L +ER+IF+ +++ +N ++ Sbjct: 2 NSAAPHGSSNWDPVGLGLVPMVVEQSGRGERAYDIYSRLLKERVIFLVGPVNDVTANLIV 61 Query: 404 ASMLYLDS 427 A +L+L+S Sbjct: 62 AQLLFLES 69
>CLPP2_METCA (Q60BE8) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 195 Score = 34.3 bits (77), Expect = 0.14 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ +++ +N V+A +L+L+S Sbjct: 16 DIYSRLLKERVIFLVGQVEDYMANLVIAQLLFLES 50
>CLPP1_NOCFA (Q5Z0M4) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 197 Score = 33.9 bits (76), Expect = 0.18 Identities = 14/35 (40%), Positives = 25/35 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L ERI+++G ID +N ++A +L+L+S Sbjct: 22 DIYSHLLAERIVYLGTPIDSGVANALIAQLLHLES 56
>CLPP_NEIMB (Q9JZ38) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 204 Score = 33.9 bits (76), Expect = 0.18 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERI+F+ + +E +N V+A +L+L+S Sbjct: 23 DIYSRLLKERIVFLVGPVTDESANLVVAQLLFLES 57
>CLPP_NEIMA (Q9JU33) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 204 Score = 33.9 bits (76), Expect = 0.18 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERI+F+ + +E +N V+A +L+L+S Sbjct: 23 DIYSRLLKERIVFLVGPVTDESANLVVAQLLFLES 57
>CLPP_NEIG1 (Q5F914) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 204 Score = 33.9 bits (76), Expect = 0.18 Identities = 14/35 (40%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERI+F+ + +E +N V+A +L+L+S Sbjct: 23 DIYSRLLKERIVFLVGPVTDESANLVVAQLLFLES 57
>CLPP_XANOR (Q5H434) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 208 Score = 33.9 bits (76), Expect = 0.18 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ ID+ +N ++A +L+L++ Sbjct: 26 DIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEA 60
>CLPP_XANCP (Q8PBY6) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 208 Score = 33.9 bits (76), Expect = 0.18 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ ID+ +N ++A +L+L++ Sbjct: 26 DIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEA 60
>CLPP_XANC8 (Q4URL4) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 208 Score = 33.9 bits (76), Expect = 0.18 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ ID+ +N ++A +L+L++ Sbjct: 26 DIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEA 60
>CLPP_XANC5 (Q3BWQ1) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 208 Score = 33.9 bits (76), Expect = 0.18 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ ID+ +N ++A +L+L++ Sbjct: 26 DIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEA 60
>CLPP_XANAC (Q8PNI5) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 208 Score = 33.9 bits (76), Expect = 0.18 Identities = 13/35 (37%), Positives = 26/35 (74%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ ID+ +N ++A +L+L++ Sbjct: 26 DIYSRLLKERLIFLVGPIDDHMANVIVAQLLFLEA 60
>CLPP_YERPS (Q66DT4) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 33.9 bits (76), Expect = 0.18 Identities = 13/35 (37%), Positives = 25/35 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ +++ +N + A ML+L++ Sbjct: 32 DIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEA 66
>CLPP_YERPE (Q8ZC65) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 33.9 bits (76), Expect = 0.18 Identities = 13/35 (37%), Positives = 25/35 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ +++ +N + A ML+L++ Sbjct: 32 DIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEA 66
>CLPP_YEREN (Q60107) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 207 Score = 33.9 bits (76), Expect = 0.18 Identities = 13/35 (37%), Positives = 25/35 (71%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ERIIF+ +++ +N + A ML+L++ Sbjct: 32 DIFSRLLKERIIFLTGQVEDHMANLITAQMLFLEA 66
>CLPP_RALSO (Q8XYP7) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 217 Score = 33.9 bits (76), Expect = 0.18 Identities = 13/35 (37%), Positives = 27/35 (77%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER+IF+ ++++ +N V+A +L+L+S Sbjct: 41 DIYSRLLKERVIFMVGEVNDQTANLVVAQLLFLES 75
>CLPP_RALEJ (Q472D3) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 216 Score = 33.9 bits (76), Expect = 0.18 Identities = 12/35 (34%), Positives = 27/35 (77%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L +ER++F+ ++++ +N V+A +L+L+S Sbjct: 41 DIYSRLLKERVVFLVGEVNDQTANLVVAQLLFLES 75
>CLPP1_RHILO (Q98M38) ATP-dependent Clp protease proteolytic subunit 1 (EC| 3.4.21.92) (Endopeptidase Clp 1) Length = 201 Score = 33.5 bits (75), Expect = 0.24 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = +2 Query: 323 DIWNALYRERIIFIGDNIDEEFSNQVLASMLYLDS 427 DI++ L RERIIFI I+++ S V A +L L+S Sbjct: 23 DIFSRLLRERIIFINGEINDDVSALVCAQLLSLES 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,166,710 Number of Sequences: 219361 Number of extensions: 1134758 Number of successful extensions: 3799 Number of sequences better than 10.0: 323 Number of HSP's better than 10.0 without gapping: 3739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3795 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
