| Clone Name | baet101g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P2SAF_ARATH (O82660) Photosystem II stability/assembly factor HC... | 69 | 4e-12 | 2 | YCF48_CYAPA (P48325) Hypothetical 37.3 kDa protein ycf48 (ORF333) | 38 | 0.007 | 3 | PTPRA_HUMAN (P18433) Receptor-type tyrosine-protein phosphatase ... | 28 | 7.3 | 4 | YC48L_SYNY3 (P73069) Ycf48-like protein | 27 | 9.5 |
|---|
>P2SAF_ARATH (O82660) Photosystem II stability/assembly factor HCF136,| chloroplast precursor Length = 403 Score = 68.6 bits (166), Expect = 4e-12 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +2 Query: 239 EDLSEWERVGLPIDPGVVLLDIAFVPDDPSHGFLLG 346 E LSEWERV LPIDPGVVLLDIAFVPD+PS GFLLG Sbjct: 80 EQLSEWERVFLPIDPGVVLLDIAFVPDEPSRGFLLG 115
>YCF48_CYAPA (P48325) Hypothetical 37.3 kDa protein ycf48 (ORF333)| Length = 333 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +2 Query: 251 EWERVGLPIDPGVVLLDIAFVPDDPSHGFLLG 346 +WE++ P++ +LLDI FVPD P G+LLG Sbjct: 32 KWEQI--PLNTDEILLDIGFVPDQPQRGWLLG 61
>PTPRA_HUMAN (P18433) Receptor-type tyrosine-protein phosphatase alpha precursor| (EC 3.1.3.48) (Protein-tyrosine phosphatase alpha) (R-PTP-alpha) Length = 802 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 342 RRNPWEGSSGTKAMSSRTTPGSMGSP 265 R PWEG+S T A + T P S +P Sbjct: 117 RTEPWEGNSSTAATTPETFPPSDETP 142
>YC48L_SYNY3 (P73069) Ycf48-like protein| Length = 342 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 254 WERVGLPIDPGVVLLDIAFVPDDPSHGFLLG 346 W+ + L D DIAF +DP+HG+L+G Sbjct: 40 WQEIALETDS--TFADIAFT-EDPNHGWLVG 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,109,044 Number of Sequences: 219361 Number of extensions: 93666 Number of successful extensions: 367 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 367 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)