| Clone Name | baet101a09 |
|---|---|
| Clone Library Name | barley_pub |
>GILT_HUMAN (P13284) Gamma-interferon-inducible lysosomal thiol reductase| precursor (Gamma-interferon-inducible protein IP-30) Length = 261 Score = 46.6 bits (109), Expect = 1e-05 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 4/66 (6%) Frame = +2 Query: 179 VSLALYYESLCPYCSRFIVTRLAGIFDSGLI--HAVDLLLVPYGNAHVRGANN--TITCQ 346 V++ LYYE+LC C F++ L F + L+ +++ LVPYGNA + + CQ Sbjct: 73 VNVTLYYEALCGGCRAFLIREL---FPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQ 129 Query: 347 HGPDEC 364 HG +EC Sbjct: 130 HGEEEC 135
>YKJ2_CAEEL (P34276) Hypothetical protein C02D5.2| Length = 323 Score = 45.1 bits (105), Expect = 4e-05 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 3/65 (4%) Frame = +2 Query: 179 VSLALYYESLCPYCSRFIVTRLAGIFDS-GLIHAVDLLLVPYGNAHV--RGANNTITCQH 349 V L +Y E+ CP SRF +L +D G ++ ++L ++P+G A +G + CQH Sbjct: 139 VKLDVYMEAQCPDTSRFFRQQLKKAWDILGRLNRIELNVIPFGKARCTEKGNDFECQCQH 198 Query: 350 GPDEC 364 GP EC Sbjct: 199 GPTEC 203
>GH34_ARATH (Q9LQ68) Indole-3-acetic acid-amido synthetase GH3.4 (EC 6.3.2.-)| (Auxin-responsive GH3-like protein 4) (AtGH3-4) (CF4-like protein) Length = 597 Score = 30.8 bits (68), Expect = 0.84 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 182 SLALYYESLCPYCSRFIVTRLAGIFDSGLIHAVDLL 289 S ++Y + LC R V RL +F SGL+ A+ L Sbjct: 205 SQSMYTQMLCGLLMRHEVNRLGAVFPSGLLRAISFL 240
>GH38_ORYSA (Q7XIN9) Probable indole-3-acetic acid-amido synthetase GH3.8 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 8) (OsGH3-8) Length = 605 Score = 30.8 bits (68), Expect = 0.84 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 188 ALYYESLCPYCSRFIVTRLAGIFDSGLIHAVDLL 289 ++Y + +C C R V RL +F SGL+ A+ L Sbjct: 215 SMYAQMVCGLCQRNDVLRLGAVFASGLLRAIRFL 248
>GH32_ARATH (Q9SZT9) Indole-3-acetic acid-amido synthetase GH3.2 (EC 6.3.2.-)| (Auxin-responsive GH3-like protein 2) (AtGH3-2) (YADOKARI 1 protein) Length = 549 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 182 SLALYYESLCPYCSRFIVTRLAGIFDSGLIHAVDLL 289 S ++Y + LC R V RL +F SGL+ A+ L Sbjct: 207 SQSMYAQMLCGLLMRHEVLRLGAVFASGLLRAISFL 242
>GH33_ARATH (O22190) Indole-3-acetic acid-amido synthetase GH3.3 (EC 6.3.2.-)| (Auxin-responsive GH3-like protein 3) (AtGH3-3) Length = 595 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 182 SLALYYESLCPYCSRFIVTRLAGIFDSGLIHAVDLL 289 S ++Y + LC R V RL +F SGL+ A+ L Sbjct: 206 SQSMYTQMLCGLLMRHEVLRLGAVFASGLLRAIGFL 241
>GH310_ORYSA (Q6ZLA7) Putative indole-3-acetic acid-amido synthetase GH3.10 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 10) (OsGH3-10) Length = 478 Score = 29.3 bits (64), Expect = 2.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 182 SLALYYESLCPYCSRFIVTRLAGIFDSGLIHAVDLL 289 S ++Y + LC C R V R+ +F + L+ A+ L Sbjct: 211 SQSMYAQMLCGLCQRHDVLRVGAVFAAALVRAIRFL 246
>GH31_ARATH (O82333) Probable indole-3-acetic acid-amido synthetase GH3.1 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 1) (AtGH3-1) Length = 590 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 188 ALYYESLCPYCSRFIVTRLAGIFDSGLIHAVDLL 289 ++Y + LC R V R+ +F SGL+ A+ L Sbjct: 208 SMYTQMLCGLLDRLSVLRVGAVFASGLLRAIRFL 241
>RENI2_MOUSE (P00796) Renin-2 precursor (EC 3.4.23.15) (Angiotensinogenase)| (Submandibular gland renin) [Contains: Renin-2 heavy chain; Renin-2 light chain] Length = 401 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -2 Query: 351 PCWQVMVLLAPRTWALP*GTSRRSTAWMSPLSKIPARR 238 P W +++L +P T++LP GT T PL K+P+ R Sbjct: 7 PLWALLLLWSPCTFSLPTGT----TFERIPLKKMPSVR 40
>RENI1_MOUSE (P06281) Renin-1 precursor (EC 3.4.23.15) (Angiotensinogenase)| (Kidney renin) Length = 402 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -2 Query: 351 PCWQVMVLLAPRTWALP*GTSRRSTAWMSPLSKIPARR 238 P W +++L +P T++LP +R +T PL K+P+ R Sbjct: 7 PLWALLLLWSPCTFSLP---TRTATFERIPLKKMPSVR 41
>FOXD3_CHICK (P79772) Forkhead box protein D3 (HNF3/FH transcription factor| genesis) (Winged helix protein CWH-3) Length = 394 Score = 28.1 bits (61), Expect = 5.5 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = -1 Query: 286 EVDGVDEPAVEDPGEAGDDEARAVGAERLVVERQGDLGRPRGSGRR 149 ++D V E + PG+ GD EAR+ A L ++ + G P + RR Sbjct: 22 DIDVVGE-GDDAPGKDGDGEARSPAALPLPLDEAAEPGEPERAARR 66
>CXA12_HUMAN (Q5T442) Gap junction alpha-12 protein (Connexin-47) (Cx47)| (Connexin-46.6) (Cx46.6) Length = 439 Score = 28.1 bits (61), Expect = 5.5 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -1 Query: 292 EQEVDGVDEPAVEDPGEAGDDEA--RAVGAERLVVERQGDLGRPRGSGR 152 E+E G E A E+ EAG +EA +AVGA+ G G+ G R Sbjct: 155 EEEETGAAEGAGEEAEEAGAEEACTKAVGADGKAAGTPGPTGQHDGRRR 203
>KCNC1_RAT (P25122) Potassium voltage-gated channel subfamily C member 1| (Voltage-gated potassium channel subunit Kv3.1) (Kv4) (NGK2) (RAW2) Length = 585 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -1 Query: 280 DGVDEPAVEDPGEAGDDEARAVGAERLVVERQGDLGRPRGSGRR 149 + D+ + PG++GD E +RL + D GRP G RR Sbjct: 129 NSADDADADGPGDSGDGEDELEMTKRLALSDSPD-GRPGGFWRR 171
>KCNC1_MOUSE (P15388) Potassium voltage-gated channel subfamily C member 1| (Voltage-gated potassium channel subunit Kv3.1) (Kv4) (NGK2) Length = 511 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -1 Query: 280 DGVDEPAVEDPGEAGDDEARAVGAERLVVERQGDLGRPRGSGRR 149 + D+ + PG++GD E +RL + D GRP G RR Sbjct: 129 NSADDADADGPGDSGDGEDELEMTKRLALSDSPD-GRPGGFWRR 171
>KCNC1_HUMAN (P48547) Potassium voltage-gated channel subfamily C member 1| (Voltage-gated potassium channel subunit Kv3.1) (Kv4) (NGK2) Length = 511 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -1 Query: 280 DGVDEPAVEDPGEAGDDEARAVGAERLVVERQGDLGRPRGSGRR 149 + D+ + PG++GD E +RL + D GRP G RR Sbjct: 129 NSADDADADGPGDSGDGEDELEMTKRLALSDSPD-GRPGGFWRR 171
>GH32_ORYSA (P0C0M2) Probable indole-3-acetic acid-amido synthetase GH3.2 (EC| 6.3.2.-) (Auxin-responsive GH3-like protein 2) (OsGH3-2) Length = 614 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 188 ALYYESLCPYCSRFIVTRLAGIFDSGLIHAVDLL 289 ++Y + LC +R V R+ +F SGL+ A+ L Sbjct: 218 SMYAQMLCGLVARAEVLRVGAVFASGLLRAIRFL 251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,529,286 Number of Sequences: 219361 Number of extensions: 358013 Number of successful extensions: 1246 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1242 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)