| Clone Name | baet101a02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PGLR2_JUNAS (Q9FY19) Polygalacturonase precursor (PG) (EC 3.2.1.... | 30 | 1.7 | 2 | YRPE_BACSU (O05410) Hypothetical protein yrpE | 29 | 2.9 | 3 | K502_ACTCH (P43394) Fruit protein PKIWI502 | 28 | 6.4 |
|---|
>PGLR2_JUNAS (Q9FY19) Polygalacturonase precursor (PG) (EC 3.2.1.15) (Pectinase)| (Major pollen allergen Jun a 2) Length = 507 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +2 Query: 95 GPAEPHLSYKIHQHSSSYPQPRDFPSEQLYHAYFAIQRF 211 GP +PH S+K+ ++YP P + + +++ + + F Sbjct: 111 GPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDF 149
>YRPE_BACSU (O05410) Hypothetical protein yrpE| Length = 251 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 128 HQHSSSYPQPRDFPSEQLYHAYFAIQRFKNTITSD 232 H+HS + D +E++Y YF + K+ + SD Sbjct: 59 HEHSHDHSHAHDEETEKIYEGYFKNSQVKDRLLSD 93
>K502_ACTCH (P43394) Fruit protein PKIWI502| Length = 317 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 91 SRPR*ATPVL*DTPAFFLVPTAT*LPKRAALPRILRHPAIQEHHHLR 231 SRP + P L P+ L + + P LRHP ++ HHH R Sbjct: 6 SRPSLSRPSLSRHPSLTLHSSLSHAPPHHRPVAFLRHPTLRYHHHGR 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,779,314 Number of Sequences: 219361 Number of extensions: 555884 Number of successful extensions: 1641 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1640 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)