| Clone Name | baet100h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ASTN_MOUSE (Q61137) Astrotactin-1 precursor (Neuronal migration ... | 30 | 2.1 | 2 | ASTN_HUMAN (O14525) Astrotactin-1 precursor | 30 | 2.1 | 3 | PMO25_SCHPO (Q9P7Q8) Mo25-like protein | 28 | 8.1 | 4 | LRP1_CHICK (P98157) Low-density lipoprotein receptor-related pro... | 28 | 8.1 | 5 | POL1_TORVR (P29150) RNA1 polyprotein (P1) [Contains: X1 protein;... | 28 | 8.1 | 6 | Y3146_BACHD (Q9K861) UPF0168 protein BH3146 | 28 | 8.1 |
|---|
>ASTN_MOUSE (Q61137) Astrotactin-1 precursor (Neuronal migration protein GC14)| Length = 1302 Score = 30.4 bits (67), Expect = 2.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 437 QAASYRSQSIDFPWCRDLCIRRLLHMCGI*CE 342 Q + Q+ PW DLC RRLL C C+ Sbjct: 445 QVVLFSQQNSSGPWAMDLCARRLLDPCEHQCD 476
>ASTN_HUMAN (O14525) Astrotactin-1 precursor| Length = 1302 Score = 30.4 bits (67), Expect = 2.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 437 QAASYRSQSIDFPWCRDLCIRRLLHMCGI*CE 342 Q + Q+ PW DLC RRLL C C+ Sbjct: 445 QVVLFSQQNSSGPWAMDLCARRLLDPCEHQCD 476
>PMO25_SCHPO (Q9P7Q8) Mo25-like protein| Length = 329 Score = 28.5 bits (62), Expect = 8.1 Identities = 19/74 (25%), Positives = 28/74 (37%), Gaps = 15/74 (20%) Frame = +2 Query: 245 LNITANKLGGIFSSAVQRRHAA---------------VPTLLSLFRYLHIIFRTCAATDE 379 L + K G+ SA+ RRH A P L+S +RY + F + E Sbjct: 86 LEFESKKDTGLIFSALLRRHVASRYPTVDYMLAHPQIFPVLVSYYRYQEVAFTAGSILRE 145 Query: 380 CTDHGTMGSQCFES 421 C+ H + S Sbjct: 146 CSRHEALNEVLLNS 159
>LRP1_CHICK (P98157) Low-density lipoprotein receptor-related protein 1| precursor (LRP) (Alpha-2-macroglobulin receptor) (A2MR) Length = 4543 Score = 28.5 bits (62), Expect = 8.1 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 6/53 (11%) Frame = +2 Query: 284 SAVQRRHAAVPTLLSLFRYLHIIF------RTCAATDECTDHGTMGSQCFESD 424 +A+ +H VPTL Y + F R+C DECT +GT C ++ Sbjct: 118 TALGCQHHCVPTLSGPACYCNNSFQLAEDRRSCKDFDECTVYGTCSQTCTNTE 170
>POL1_TORVR (P29150) RNA1 polyprotein (P1) [Contains: X1 protein; X2 protein;| Putative ATP-dependent helicase (EC 3.6.1.-) (NTP-binding protein) (NTB) (Membrane-binding protein); Viral genome-linked protein (VPg); Picornain 3C-like protease (EC 3.4.22.-) Length = 2197 Score = 28.5 bits (62), Expect = 8.1 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 212 LHQNQIQETALLNITANKLGGIFSSAVQRRHAA 310 LH + Q TA+ N N++GG F S Q RH A Sbjct: 1977 LHGDVEQFTAVRNFYVNQIGGNFLSLPQWRHCA 2009
>Y3146_BACHD (Q9K861) UPF0168 protein BH3146| Length = 153 Score = 28.5 bits (62), Expect = 8.1 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -2 Query: 347 CEDNGTEIEESEPQHGAVALQRRKSPPTC 261 C NGT + +S P H +++RR+ +C Sbjct: 6 CHHNGTRVLDSRPAHEGRSIRRRRECESC 34 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,241,858 Number of Sequences: 219361 Number of extensions: 1069805 Number of successful extensions: 3624 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3623 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)