| Clone Name | baet09g09 |
|---|---|
| Clone Library Name | barley_pub |
>TSSP_MOUSE (Q9QXE5) Thymus-specific serine protease precursor (EC 3.4.-.-)| Length = 509 Score = 40.8 bits (94), Expect = 0.002 Identities = 26/74 (35%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = +3 Query: 213 LKNTTPAESSY--RLWWYQVCSEVSYFQVAPKNDSVRSTKIDTRYHLDLCKNVFG---EG 377 L NT P S R W YQ C+E ++ S + L+LC+ VFG Sbjct: 357 LSNTEPQVSGVGDRQWLYQTCTEFGFYVTCEGLQCPFSQLPALPFQLELCEQVFGLSPAS 416 Query: 378 VYPDVSMTNLYYGG 419 V V+ TN YYGG Sbjct: 417 VAQAVAQTNSYYGG 430
>YM67_CAEEL (P34528) Putative serine protease K12H4.7 precursor (EC 3.4.-.-)| Length = 510 Score = 39.3 bits (90), Expect = 0.004 Identities = 35/138 (25%), Positives = 57/138 (41%), Gaps = 14/138 (10%) Frame = +3 Query: 48 AAAIAFQYGNPDVLCSPLVEAKKNGTDLVEAFAHYVNSYYVGRFKASVASYDQ--KYLKN 221 A + A Q +C + K ++ Y N G F + Y+ ++K+ Sbjct: 301 AGSFATQLTISHAICRYHINTKSTPLQKLKQVNDYFNQVS-GYFGCNDIDYNGFISFMKD 359 Query: 222 TTPAES-SYRLWWYQVCSEVSYFQ------VAPKNDSVRSTKIDTRYHLDLCKNVFG--- 371 T E+ S R W +Q C+E Y+Q P V + + +Y++D C ++G Sbjct: 360 ETFGEAQSDRAWVWQTCTEFGYYQSTSSATAGPWFGGV--SNLPAQYYIDECTAIYGAAY 417 Query: 372 --EGVYPDVSMTNLYYGG 419 + V V TN YYGG Sbjct: 418 NSQEVQTSVDYTNQYYGG 435
>TSSP_HUMAN (Q9NQE7) Thymus-specific serine protease precursor (EC 3.4.-.-)| Length = 514 Score = 38.9 bits (89), Expect = 0.006 Identities = 27/81 (33%), Positives = 35/81 (43%), Gaps = 5/81 (6%) Frame = +3 Query: 213 LKNTTPAESSY--RLWWYQVCSEVSYFQVAPKNDSVRSTKIDTRYHLDLCKNVFG---EG 377 L++T P S R W YQ C+E ++ S LDLC+ VFG Sbjct: 358 LRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALS 417 Query: 378 VYPDVSMTNLYYGGTRIAGSK 440 V V+ TN YYGG +K Sbjct: 418 VAQAVAQTNSYYGGQTPGANK 438
>YM9I_CAEEL (P90893) Putative serine protease F56F10.1 precursor (EC 3.4.-.-)| Length = 540 Score = 36.6 bits (83), Expect = 0.028 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 5/69 (7%) Frame = +3 Query: 228 PAESSYRLWWYQVCSEVSYFQVAPKNDSVRSTKIDTRYHLDLCKNVFGEGVYPDVSM--- 398 P ++ R W + C+E+ + Q + ++V T + +D+C ++FG+ + M Sbjct: 368 PDGAAARGWMWLCCNEIGFLQTTNQGNNVFGTGVPLNLFIDMCTDMFGDSMKMSQIMGGN 427 Query: 399 --TNLYYGG 419 + YYGG Sbjct: 428 KKSQNYYGG 436
>MLH3_HUMAN (Q9UHC1) DNA mismatch repair protein Mlh3 (MutL protein homolog 3)| Length = 1453 Score = 32.0 bits (71), Expect = 0.70 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 5/68 (7%) Frame = -2 Query: 369 QKHFCTSLNGILYRSL*SGRYHFLVPLGNMKPHCKLDTTTIYMKIQLE-----LCSSNTS 205 Q+HF +L ++Y + +G F+ P +++ C D TT+ + + LE C S Sbjct: 1045 QRHFDVALGRMVYVNKMTGLSTFIAPTEDIQAACTKDLTTVAVDVVLENGSQYRCQPFRS 1104 Query: 204 DHMMQLMP 181 D ++ +P Sbjct: 1105 DLVLPFLP 1112
>AROK_ARATH (Q9SJ05) Probable shikimate kinase, chloroplast precursor (EC| 2.7.1.71) Length = 292 Score = 30.4 bits (67), Expect = 2.0 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 90 CSPLVEAKKNGTDLVEAFAHYVNSYYVGRFKASVASYDQKY 212 C L+E NGT + E F H+ +++ G+ ++ +Y Sbjct: 133 CDTLIEQAMNGTSVAEIFVHHGENFFRGKETDALKKLSSRY 173
>TARP2_CHLTR (Q6GX35) Translocated actin-recruiting phosphoprotein (Tarp| protein) Length = 1005 Score = 30.4 bits (67), Expect = 2.0 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 3 KMLENDGDFLYLLADAAA-IAFQYGNPDVLCSPLVEAKKNGTDL 131 KMLEN G F+++ D ++ I GN D +CS V+ K DL Sbjct: 469 KMLENSGHFVFIDTDRSSFILVPNGNWDQVCSIKVQNGKTKEDL 512
>TARP1_CHLTR (O84462) Translocated actin-recruiting phosphoprotein (Tarp| protein) Length = 1005 Score = 30.4 bits (67), Expect = 2.0 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 3 KMLENDGDFLYLLADAAA-IAFQYGNPDVLCSPLVEAKKNGTDL 131 KMLEN G F+++ D ++ I GN D +CS V+ K DL Sbjct: 347 KMLENSGHFVFIDTDRSSFILVPNGNWDQVCSIKVQNGKTKEDL 390
>SORL_MOUSE (O88307) Sortilin-related receptor precursor (Sorting protein-related| receptor containing LDLR class A repeats) (mSorLA) (SorLA-1) (Low-density lipoprotein receptor relative with 11 ligand-binding repeats) (LDLR relative with 11 ligand-binding Length = 2215 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 315 GRYHFLVPLGNMKPHCKLDTTTIYMKIQLELCSSNTSDHMM 193 G+YH +V LGNM + TT+ + L +DH++ Sbjct: 2001 GKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVL 2041
>SORL_HUMAN (Q92673) Sortilin-related receptor precursor (Sorting protein-related| receptor containing LDLR class A repeats) (SorLA) (SorLA-1) (Low-density lipoprotein receptor relative with 11 ligand-binding repeats) (LDLR relative with 11 ligand-binding Length = 2214 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 315 GRYHFLVPLGNMKPHCKLDTTTIYMKIQLELCSSNTSDHMM 193 G+YH +V LGNM + TT+ + L +DH++ Sbjct: 2000 GKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVL 2040
>INGR1_MOUSE (P15261) Interferon-gamma receptor alpha chain precursor| (IFN-gamma-R1) (CD119 antigen) Length = 477 Score = 30.0 bits (66), Expect = 2.7 Identities = 19/48 (39%), Positives = 24/48 (50%) Frame = +3 Query: 252 WWYQVCSEVSYFQVAPKNDSVRSTKIDTRYHLDLCKNVFGEGVYPDVS 395 W YQ S+ F V K S T T D C N++G+ +YPDVS Sbjct: 57 WEYQNMSQTPIFTVQVKVYSGSWTDSCTNIS-DHCCNIYGQIMYPDVS 103
>SORL_RABIT (Q95209) Sortilin-related receptor precursor (Sorting protein-related| receptor containing LDLR class A repeats) (SorLA) (SorLA-1) (Low-density lipoprotein receptor relative with 11 ligand-binding repeats) (LDLR relative with 11 ligand-binding Length = 2213 Score = 29.6 bits (65), Expect = 3.5 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 315 GRYHFLVPLGNMKPHCKLDTTTIYMKIQLELCSSNTSDHMM 193 G+YH +V LGNM + TT+ + L +DH++ Sbjct: 1999 GKYHVIVQLGNMSKDASVKITTVSLSAPDALKIITENDHVL 2039
>MK14B_DROME (O61443) Mitogen-activated protein kinase 14B (EC 2.7.11.24) (MAP| kinase p38b) (D-p38b) Length = 365 Score = 29.3 bits (64), Expect = 4.5 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 135 EAFAH-YVNSYYVGRFKASVASYDQKYLKNTTPAESSYRLWWYQVCSEVSYFQ 290 +A AH Y+ Y+ + + A YDQ + +N P E W V SEV+ F+ Sbjct: 304 QALAHPYMEKYHDPTDEQTAALYDQSFEENELPVEK----WREMVFSEVTAFK 352
>YGS6_YEAST (P46945) Hypothetical 63.3 kDa protein in MPT5-SAE2 intergenic| region Length = 554 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -2 Query: 360 FCTSLNGILYRSL*SGRYHFLVPLGNMKPHCKLD 259 FCT+L+G L G L P+G MK +C+L+ Sbjct: 450 FCTTLSGNLDYEKSEGGNITLYPIGGMKNYCRLE 483
>ATG27_ASHGO (Q757Z8) Autophagy-related protein 27 precursor| Length = 297 Score = 28.9 bits (63), Expect = 5.9 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 156 NSYYVGRFKASVASYDQKYLKNTTPAESSYRLWWYQVCSEVS 281 +S + R+K S + K+ ++T P+E++ WW +C E S Sbjct: 24 DSKVLSRYKVSQHAAKGKFTESTPPSETT-DFWWINLCEEHS 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,121,859 Number of Sequences: 219361 Number of extensions: 1253773 Number of successful extensions: 3075 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 3024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3072 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)