| Clone Name | baet09f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GUN1_RUMAL (P16216) Endoglucanase 1 precursor (EC 3.2.1.4) (Endo... | 29 | 4.2 | 2 | GUNB_RUMAL (P23661) Endoglucanase B precursor (EC 3.2.1.4) (Endo... | 29 | 4.2 |
|---|
>GUN1_RUMAL (P16216) Endoglucanase 1 precursor (EC 3.2.1.4) (Endoglucanase I)| (Endo-1,4-beta-glucanase) (Cellulase) (EG-I) Length = 406 Score = 28.9 bits (63), Expect = 4.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 15 VIQRSSKDYSSNLVQSGGNMGDQSTLITGYFA 110 +I K + + SGGN GD+ +ITGY A Sbjct: 229 IINEYEKAFVETVRASGGNNGDRCLMITGYAA 260
>GUNB_RUMAL (P23661) Endoglucanase B precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase) (Cellulase) (EGB) Length = 409 Score = 28.9 bits (63), Expect = 4.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 15 VIQRSSKDYSSNLVQSGGNMGDQSTLITGYFA 110 +I K + + SGGN GD+ +ITGY A Sbjct: 231 IINEYEKAFVETVRASGGNNGDRCLMITGYAA 262 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,295,900 Number of Sequences: 219361 Number of extensions: 185264 Number of successful extensions: 553 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 80,573,946 effective HSP length: 16 effective length of database: 77,064,170 effective search space used: 1849540080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)