| Clone Name | baet08g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UDU2_ARATH (Q9FHD4) DUF26 domain-containing protein 2 precursor | 36 | 0.025 | 2 | UDU1_ARATH (Q9FHD5) DUF26 domain-containing protein 1 precursor | 31 | 0.81 | 3 | BMP1_MOUSE (P98063) Bone morphogenetic protein 1 precursor (EC 3... | 29 | 3.1 | 4 | UDU3_ARATH (Q9FHD3) Hypothetical DUF26 domain-containing protein... | 28 | 4.0 |
|---|
>UDU2_ARATH (Q9FHD4) DUF26 domain-containing protein 2 precursor| Length = 287 Score = 35.8 bits (81), Expect = 0.025 Identities = 24/85 (28%), Positives = 35/85 (41%), Gaps = 4/85 (4%) Frame = +1 Query: 154 SGVDAIGTYCAK---NGTSAET-QAGIDQVLAALVPXXXXXXXXXXXXXXXXXXVWGLAQ 321 S D + T+C K N TS T ++ +L+ L V G+ Sbjct: 24 SDPDDMETFCMKSSRNTTSNTTYNKNLNTLLSTLSNQSSFANYYNLTTGLASDTVHGMFL 83 Query: 322 CRGDVPRQDCSLCLAAAAKEVASSC 396 C GDV R C+ C+ A E+A +C Sbjct: 84 CTGDVNRTTCNACVKNATIEIAKNC 108
>UDU1_ARATH (Q9FHD5) DUF26 domain-containing protein 1 precursor| Length = 286 Score = 30.8 bits (68), Expect = 0.81 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 304 VWGLAQCRGDVPRQDCSLCLAAAAKEVASSC 396 V G+ C GDV R C+ C+ A E+A +C Sbjct: 79 VHGMFLCIGDVNRTTCNACVKNATIEIAKNC 109
>BMP1_MOUSE (P98063) Bone morphogenetic protein 1 precursor (EC 3.4.24.19)| (BMP-1) (Procollagen C-proteinase) (PCP) (Mammalian tolloid protein) (mTld) Length = 991 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 321 VPRRRPASGLLALPRRGGQGGRVVLPR 401 +P RRPA+GL L R G+GGR P+ Sbjct: 23 LPARRPAAGLGRLHLRPGRGGRPGAPQ 49
>UDU3_ARATH (Q9FHD3) Hypothetical DUF26 domain-containing protein 3 precursor| Length = 287 Score = 28.5 bits (62), Expect = 4.0 Identities = 19/85 (22%), Positives = 33/85 (38%), Gaps = 4/85 (4%) Frame = +1 Query: 154 SGVDAIGTYC---AKNGTSAET-QAGIDQVLAALVPXXXXXXXXXXXXXXXXXXVWGLAQ 321 S D + T+C ++N T T ++ +L+ V+G+ Sbjct: 28 SETDHMDTFCIDSSRNTTGNTTYNKNLNTMLSTFRNQSSIVNNYNLTTGLASDTVYGMFL 87 Query: 322 CRGDVPRQDCSLCLAAAAKEVASSC 396 C GDV C+ C+ A E+ +C Sbjct: 88 CTGDVNITTCNNCVKNATIEIVKNC 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,863,429 Number of Sequences: 219361 Number of extensions: 251671 Number of successful extensions: 678 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)