| Clone Name | baet07h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloro... | 74 | 7e-14 | 2 | PTW3C_BACSU (P39816) Putative PTS system glucosamine-specific EI... | 29 | 3.6 | 3 | C8AP2_HUMAN (Q9UKL3) CASP8-associated protein 2 (FLICE-associate... | 28 | 6.1 |
|---|
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 74.3 bits (181), Expect = 7e-14 Identities = 42/90 (46%), Positives = 55/90 (61%) Frame = +2 Query: 5 AALAPTKMLGTRLDFAGSSRYATAAPTAGAQKIVSLFDRFNXXXXXXXXXXXVATSSAGI 184 A+L ++MLGT L+F SR ++AP A + F+ V+ +S Sbjct: 2 ASLGVSEMLGTPLNFRAVSR--SSAPLASSPSTFKTVALFSKKKPAPAKSKAVSETS--- 56 Query: 185 DDELAKWYGPDRRIYLPNGLLDRSEVPEYL 274 DELAKWYGPDRRI+LP+GLLDRSE+PEYL Sbjct: 57 -DELAKWYGPDRRIFLPDGLLDRSEIPEYL 85
>PTW3C_BACSU (P39816) Putative PTS system glucosamine-specific EIICBA component| [Includes: Glucosamine permease IIC component (PTS system glucosamine-specific EIIC component); Glucosamine-specific phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS Length = 631 Score = 28.9 bits (63), Expect = 3.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 102 IFCAPAVGAAVAYLEEPAKSSRVPSILVGAS 10 IFC PAV A+ + P K + +++ A+ Sbjct: 252 IFCLPAVALAIIHTARPEKKKMISGVMISAA 282
>C8AP2_HUMAN (Q9UKL3) CASP8-associated protein 2 (FLICE-associated huge protein)| Length = 1982 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 268 LRHLRPVKEAVGQVDPPVRAV 206 L HLRP+ EA+ ++ PVR V Sbjct: 847 LNHLRPIPEAISPLNSPVRPV 867 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,528,596 Number of Sequences: 219361 Number of extensions: 341182 Number of successful extensions: 1236 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1236 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)