| Clone Name | baet07d07 |
|---|---|
| Clone Library Name | barley_pub |
>GALT7_DROME (Q8MV48) N-acetylgalactosaminyltransferase 7 (EC 2.4.1.-)| (Protein-UDP acetylgalactosaminyltransferase 7) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7) (pp-GaNTase 7) (dGalNAc-T2) Length = 591 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 193 FKGLQVAIKCKNVDGEYESKAVGALDGTGAFSVPLDAN 306 FKGL I+ K +G +++ GA++ TG V LDA+ Sbjct: 200 FKGLVKVIRNKEREGLIRTRSRGAMEATGEVIVFLDAH 237
>DLGP3_RAT (P97838) Disks large-associated protein 3 (DAP-3)| (SAP90/PSD-95-associated protein 3) (SAPAP3) (PSD-95/SAP90-binding protein 3) Length = 977 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 205 QVAIKCKNVDGEYESKAVGALDGTGAFSVPLDANLR 312 Q+ C +V GE ES+AV ALD G F + + LR Sbjct: 468 QLEAVCGSVFGELESQAVDALDLPGCFRMRSHSYLR 503
>DLGP3_MOUSE (Q6PFD5) Disks large-associated protein 3 (DAP-3)| (SAP90/PSD-95-associated protein 3) (SAPAP3) (PSD-95/SAP90-binding protein 3) Length = 977 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 205 QVAIKCKNVDGEYESKAVGALDGTGAFSVPLDANLR 312 Q+ C +V GE ES+AV ALD G F + + LR Sbjct: 468 QLEAVCGSVFGELESQAVDALDLPGCFRMRSHSYLR 503
>DLGP3_HUMAN (O95886) Disks large-associated protein 3 (DAP-3)| (SAP90/PSD-95-associated protein 3) (SAPAP3) (PSD-95/SAP90-binding protein 3) Length = 979 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 205 QVAIKCKNVDGEYESKAVGALDGTGAFSVPLDANLR 312 Q+ C +V GE ES+AV ALD G F + + LR Sbjct: 470 QLEAVCGSVFGELESQAVDALDLPGCFRMRSHSYLR 505
>ISPG_BACFR (Q64N34) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (EC| 1.17.4.3) (1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase) Length = 626 Score = 27.7 bits (60), Expect = 7.6 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 136 VGLAKCADCTRKNIKAEEAFKGLQVAIKCKNVDGEYESK 252 + L K +C KNI EEA + L IK +G+YE K Sbjct: 578 ISLYKQKECIEKNIPEEEAVEKLIELIK---ANGDYEEK 613
>ISPG_BACFN (Q5L7W2) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (EC| 1.17.4.3) (1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase) Length = 626 Score = 27.7 bits (60), Expect = 7.6 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 136 VGLAKCADCTRKNIKAEEAFKGLQVAIKCKNVDGEYESK 252 + L K +C KNI EEA + L IK +G+YE K Sbjct: 578 ISLYKQKECIEKNIPEEEAVEKLIELIK---ANGDYEEK 613
>FLAB2_AERPE (Q9YAN6) Probable flagellin 2 precursor| Length = 246 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 196 KGLQVAIKCKNVDGEYESKAVGALDGTGAFSVPLDA 303 +GL+ A VDG ++A+ A TG++++ +DA Sbjct: 47 RGLEEATSALEVDGSVIARAIDADTTTGSYNIVVDA 82
>WDR63_MACFA (Q95JP0) WD-repeat protein 63| Length = 891 Score = 27.3 bits (59), Expect = 10.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 236 PSTFLHLIATWRPL 195 PSTFLHL +W+PL Sbjct: 551 PSTFLHLDLSWKPL 564
>WDR63_HUMAN (Q8IWG1) WD-repeat protein 63 (Testis development protein NYD-SP29)| Length = 891 Score = 27.3 bits (59), Expect = 10.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 236 PSTFLHLIATWRPL 195 PSTFLHL +W+PL Sbjct: 551 PSTFLHLDLSWKPL 564 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,695,745 Number of Sequences: 219361 Number of extensions: 261211 Number of successful extensions: 1128 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1128 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)