| Clone Name | baet07a05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YR837_MIMIV (Q5UQI8) Putative ankyrin repeat protein R837 | 30 | 2.3 | 2 | ICAL_SHEEP (Q95208) Calpastatin (Calpain inhibitor) | 29 | 5.2 | 3 | NMD3B_MOUSE (Q91ZU9) Glutamate [NMDA] receptor subunit 3B precur... | 29 | 6.8 | 4 | NMD3B_RAT (Q8VHN2) Glutamate [NMDA] receptor subunit 3B precurso... | 29 | 6.8 |
|---|
>YR837_MIMIV (Q5UQI8) Putative ankyrin repeat protein R837| Length = 626 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 26 GAYLLSRNILAMSFAPRDSHEAQVQFALERGV 121 GA + SRN A+ FA ++ H V+F +E+GV Sbjct: 134 GANIKSRNNYALRFAVKNGHYNMVKFLIEQGV 165
>ICAL_SHEEP (Q95208) Calpastatin (Calpain inhibitor)| Length = 723 Score = 29.3 bits (64), Expect = 5.2 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -1 Query: 160 GEPVGGEDPDHRRHPTFQRELHLRLVRVPRSERHGQDVA*QQIRSP 23 G+P E P H+R P QR +L++ R P + G A Q++ P Sbjct: 634 GKPKRSESPRHQRSPRHQR--NLQVPRTPLTPSQGTWTAVPQLQKP 677
>NMD3B_MOUSE (Q91ZU9) Glutamate [NMDA] receptor subunit 3B precursor| (N-methyl-D-aspartate receptor subunit NR3B) (NR3B) (NMDAR3B) (NMDA receptor NR4) (Nr4) Length = 1003 Score = 28.9 bits (63), Expect = 6.8 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = +2 Query: 260 RPGGYWILSGPPINWKKHSKGWQRTREDLNAEQQEDQGGWR 382 R G W+ ++ +H K W R+ L A G W+ Sbjct: 350 RTGAVWVAGSSQVHVSRHFKVWSLRRDPLGAPAWATVGSWQ 390
>NMD3B_RAT (Q8VHN2) Glutamate [NMDA] receptor subunit 3B precursor| (N-methyl-D-aspartate receptor subtype 3B) (NR3B) (NMDAR3B) Length = 1002 Score = 28.9 bits (63), Expect = 6.8 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = +2 Query: 260 RPGGYWILSGPPINWKKHSKGWQRTREDLNAEQQEDQGGWR 382 R G W+ ++ +H K W R+ L A G W+ Sbjct: 350 RTGAVWVTGSSQVHVSRHFKVWSLRRDPLGAPAWATVGSWQ 390 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,524,838 Number of Sequences: 219361 Number of extensions: 1203746 Number of successful extensions: 2578 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2577 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)