| Clone Name | baet06d09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KCNH6_RAT (O54853) Potassium voltage-gated channel subfamily H m... | 31 | 1.1 |
|---|
>KCNH6_RAT (O54853) Potassium voltage-gated channel subfamily H member 6| (Voltage-gated potassium channel subunit Kv11.2) (Ether-a-go-go-related gene potassium channel 2) (Ether-a-go-go-related protein 2) (Eag-related protein 2) Length = 950 Score = 31.2 bits (69), Expect = 1.1 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = -3 Query: 410 PCEGDIAGVSAFRANVLAIKLVLLINSRANITTNKLNKSFLGASSNSPRPERRMACPGRG 231 P + + V F N + +L +S ++T L+ SFLG+ + RP + PGRG Sbjct: 114 PVKNEDGAVIMFILNFEDLAQLLAKSSSRSLTQRLLSHSFLGSEGSHSRPSGQGPGPGRG 173 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.134 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,357,525 Number of Sequences: 219361 Number of extensions: 675249 Number of successful extensions: 1618 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1618 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)