| Clone Name | baet06d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CDI8_ARATH (P42735) Cadmium-induced protein AS8 | 84 | 2e-16 | 2 | GRLF1_CANFA (P83509) Glucocorticoid receptor DNA-binding factor ... | 32 | 0.95 | 3 | EMAL_DROME (Q9VUI3) Echinoderm microtubule-associated protein-li... | 30 | 3.6 | 4 | MMP11_HUMAN (P24347) Stromelysin-3 precursor (EC 3.4.24.-) (ST3)... | 29 | 4.7 | 5 | GRLF1_MOUSE (Q91YM2) Glucocorticoid receptor DNA-binding factor ... | 29 | 6.2 |
|---|
>CDI8_ARATH (P42735) Cadmium-induced protein AS8| Length = 171 Score = 83.6 bits (205), Expect = 2e-16 Identities = 41/75 (54%), Positives = 48/75 (64%) Frame = +1 Query: 223 MIIKGMLGRYERWNPVHPTXXXXXXXXXXXXXXXXXXXXXXXEVIGYVGAGCGVGFSVGI 402 MIIKG+ RYE+WNPVHPT EVIGYVGAGCGVGFSVGI Sbjct: 4 MIIKGIFRRYEKWNPVHPTYGAFWGMGIGIGCGVGWGPGFGPEVIGYVGAGCGVGFSVGI 63 Query: 403 TLAGVGVGLPQHGII 447 TLAG+G+GLP + ++ Sbjct: 64 TLAGLGIGLPTNFLL 78
>GRLF1_CANFA (P83509) Glucocorticoid receptor DNA-binding factor 1 (Rho GAP p190A)| (p190-A) Length = 1500 Score = 31.6 bits (70), Expect = 0.95 Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 53 FLHSSRRCSCPSPTKSTNPRPQ-PIQTLLPPRLQ 151 FL S+ S PSP +S P PQ P+Q LLP +LQ Sbjct: 1462 FLTSTPVTSQPSPPQSPPPTPQSPMQALLPSQLQ 1495
>EMAL_DROME (Q9VUI3) Echinoderm microtubule-associated protein-like CG13466| Length = 819 Score = 29.6 bits (65), Expect = 3.6 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 9/53 (16%) Frame = -3 Query: 165 IAPGICSRGGNRVWIGWGRGLVDLVG---------LGHEQRRLLWRKNTLVWS 34 I G R +V G GR L L GH++ LWRKN L+W+ Sbjct: 529 ILEGSLQRRFTQVVFGHGRQLWGLAAHPDDELYATAGHDKHVALWRKNKLIWT 581
>MMP11_HUMAN (P24347) Stromelysin-3 precursor (EC 3.4.24.-) (ST3) (SL-3) (Matrix| metalloproteinase-11) (MMP-11) Length = 488 Score = 29.3 bits (64), Expect = 4.7 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 9/46 (19%) Frame = +2 Query: 47 VFFLHSSRRC---------SCPSPTKSTNPRPQPIQTLLPPRLQMP 157 V LH+ RR S P+P +T P+P +L PPR +P Sbjct: 38 VHHLHAERRGPQPWHAALPSSPAPAPATQEAPRPASSLRPPRCGVP 83
>GRLF1_MOUSE (Q91YM2) Glucocorticoid receptor DNA-binding factor 1 (Fragment)| Length = 1337 Score = 28.9 bits (63), Expect = 6.2 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 53 FLHSSRRCSCPSPTKSTNPRPQ-PIQTLLPPRLQ 151 FL S+ S PSP +S P PQ P+Q LL +LQ Sbjct: 1299 FLTSTPATSQPSPPQSPPPTPQSPMQPLLSSQLQ 1332 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,373,277 Number of Sequences: 219361 Number of extensions: 542197 Number of successful extensions: 2497 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2454 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)