| Clone Name | baet06c11 |
|---|---|
| Clone Library Name | barley_pub |
>GP124_MOUSE (Q91ZV8) Probable G-protein coupled receptor 124 precursor (Tumor| endothelial marker 5) Length = 1329 Score = 31.6 bits (70), Expect = 0.87 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 7/50 (14%) Frame = -3 Query: 255 SSLAWFRVPCFTVLNRSLSMAPPP-------PPQGRSLARTYLVNGTVPL 127 SSL W V VL++ LS PP PP R + R YL+ G +PL Sbjct: 839 SSLLWMGVKA-RVLHKELSWRAPPLEEGEAAPPGPRPMLRFYLIAGGIPL 887
>TS1R1_MOUSE (Q99PG6) Taste receptor type 1 member 1 precursor (G-protein| coupled receptor 70) Length = 842 Score = 28.9 bits (63), Expect = 5.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 74 GSNKLCRECHGSARWS 27 G+N+LCRECH W+ Sbjct: 360 GTNQLCRECHAFTTWN 375
>PAX8_MOUSE (Q00288) Paired box protein Pax-8| Length = 457 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 207 SLSMAPPPPPQGRSLARTYLVNGTVPLA 124 S ++ PP PQ SL TY +NG + +A Sbjct: 162 SSAVTPPESPQSDSLGSTYSINGLLGIA 189
>PAX8_HUMAN (Q06710) Paired box protein Pax-8| Length = 450 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 207 SLSMAPPPPPQGRSLARTYLVNGTVPLA 124 S ++ PP PQ SL TY +NG + +A Sbjct: 162 SSAVTPPESPQSDSLGSTYSINGLLGIA 189
>PAX8_CANFA (P47240) Paired box protein Pax-8| Length = 459 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 207 SLSMAPPPPPQGRSLARTYLVNGTVPLA 124 S ++ PP PQ SL TY +NG + +A Sbjct: 162 SSAVTPPESPQSDSLGSTYSINGLLGIA 189
>ATN1_HUMAN (P54259) Atrophin-1 (Dentatorubral-pallidoluysian atrophy protein)| Length = 1185 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 192 PPPPPQGRSLARTYLVNGTVPLATTVLHTA 103 PPPPP GR LA + G P +T TA Sbjct: 443 PPPPPYGRLLANSNAHPGPFPPSTGAQSTA 472
>ATN1_PANTR (Q5IS70) Atrophin-1 (Dentatorubral-pallidoluysian atrophy protein)| Length = 1186 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 192 PPPPPQGRSLARTYLVNGTVPLATTVLHTA 103 PPPPP GR LA + G P +T TA Sbjct: 442 PPPPPYGRLLANSNAHPGPFPPSTGAQSTA 471
>VL2_HPV38 (Q80912) Minor capsid protein L2| Length = 527 Score = 28.1 bits (61), Expect = 9.7 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -3 Query: 213 NRSLSMAPPPPPQGRSLARTYLVNGTVPLATTVLHTAGSCELASQL 76 N L +A P PP +++RT N + + V+ T+G LA + Sbjct: 161 NAILEVADPHPPTRATVSRTQYNNPAFQIISEVIPTSGESSLADHV 206 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,977,583 Number of Sequences: 219361 Number of extensions: 871421 Number of successful extensions: 3584 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3553 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)