ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet06b12 |
|---|---|
| Clone Library Name | barley_pub |
>BAS1_WHEAT (P80602) 2-cys peroxiredoxin BAS1, chloroplast precursor (EC| 1.11.1.15) (Thiol-specific antioxidant protein) (Fragment) Length = 210 Score = 133 bits (335), Expect = 2e-31 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +2 Query: 236 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD Sbjct: 14 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 73 Query: 416 RHE 424 RHE Sbjct: 74 RHE 76
>BAS1_HORVU (Q96468) 2-cys peroxiredoxin BAS1, chloroplast precursor (EC| 1.11.1.15) (Thiol-specific antioxidant protein) (Fragment) Length = 210 Score = 133 bits (335), Expect = 2e-31 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +2 Query: 236 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD Sbjct: 14 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 73 Query: 416 RHE 424 RHE Sbjct: 74 RHE 76
>BAS1_ARATH (Q96291) 2-cys peroxiredoxin BAS1, chloroplast precursor (EC| 1.11.1.15) Length = 266 Score = 122 bits (307), Expect = 3e-28 Identities = 58/60 (96%), Positives = 58/60 (96%) Frame = +2 Query: 242 DLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 421 DLPLVGNKAPDF AEAVFDQEFI VKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH Sbjct: 71 DLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 130
>BAS1_SPIOL (O24364) 2-cys peroxiredoxin BAS1, chloroplast precursor (EC| 1.11.1.15) (Thiol-specific antioxidant protein) Length = 265 Score = 122 bits (307), Expect = 3e-28 Identities = 58/60 (96%), Positives = 58/60 (96%) Frame = +2 Query: 242 DLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 421 DLPLVGNKAPDF AEAVFDQEFI VKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH Sbjct: 71 DLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 130
>YCF42_PORPU (P51272) Putative peroxiredoxin ycf42 (EC 1.11.1.15) (Thioredoxin| reductase) Length = 199 Score = 87.4 bits (215), Expect = 1e-17 Identities = 42/56 (75%), Positives = 48/56 (85%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 421 VG APDF+A AV+DQEF +KLSD+ KYVILFFYPLDFTFVCPTEITAFSD++ Sbjct: 10 VGQIAPDFSATAVYDQEFKTIKLSDF-KNKYVILFFYPLDFTFVCPTEITAFSDKY 64
>Y755_SYNY3 (Q55624) Putative peroxiredoxin sll0755 (EC 1.11.1.15) (Thioredoxin| reductase) Length = 200 Score = 84.7 bits (208), Expect = 8e-17 Identities = 41/56 (73%), Positives = 44/56 (78%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 421 VG APDF A A+ DQ F VKLS Y GK Y++LFFYPLDFTFVCPTEI AFSDRH Sbjct: 7 VGQPAPDFTATAIVDQSFQTVKLSTYRGK-YLVLFFYPLDFTFVCPTEIIAFSDRH 61
>PRDX2_MOUSE (Q61171) Peroxiredoxin-2 (EC 1.11.1.15) (Thioredoxin peroxidase 1)| (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) Length = 197 Score = 81.6 bits (200), Expect = 7e-16 Identities = 40/57 (70%), Positives = 43/57 (75%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +G APDF A AV D F +KLSDY GK YV+LFFYPLDFTFVCPTEI AFSD E Sbjct: 7 IGKSAPDFTATAVVDGAFKEIKLSDYRGK-YVVLFFYPLDFTFVCPTEIIAFSDHAE 62
>PRDX2_HUMAN (P32119) Peroxiredoxin-2 (EC 1.11.1.15) (Thioredoxin peroxidase 1)| (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) (PRP) (Natural killer cell-enhancing factor B) (NKEF-B) Length = 197 Score = 81.3 bits (199), Expect = 9e-16 Identities = 41/57 (71%), Positives = 44/57 (77%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +G APDF A AV D F VKLSDY GK YV+LFFYPLDFTFVCPTEI AFS+R E Sbjct: 7 IGKPAPDFKATAVVDGAFKEVKLSDYKGK-YVVLFFYPLDFTFVCPTEIIAFSNRAE 62
>PRDX2_BOVIN (Q9BGI3) Peroxiredoxin-2 (EC 1.11.1.15)| Length = 199 Score = 81.3 bits (199), Expect = 9e-16 Identities = 41/55 (74%), Positives = 43/55 (78%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 VG AP+F A AV D F VKLSDY GK YV+LFFYPLDFTFVCPTEI AFSDR Sbjct: 9 VGKPAPEFQATAVVDGAFKEVKLSDYKGK-YVVLFFYPLDFTFVCPTEIVAFSDR 62
>PRDX2_RAT (P35704) Peroxiredoxin-2 (EC 1.11.1.15) (Thioredoxin peroxidase 1)| (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) Length = 197 Score = 79.7 bits (195), Expect = 3e-15 Identities = 39/57 (68%), Positives = 42/57 (73%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +G APDF AV D F +KLSDY GK YV+LFFYPLDFTFVCPTEI AFSD E Sbjct: 7 IGKPAPDFTGTAVVDGAFKEIKLSDYRGK-YVVLFFYPLDFTFVCPTEIIAFSDHAE 62
>PRDX_ASCSU (Q9NL98) Peroxiredoxin (EC 1.11.1.15) (AsPrx) (Thioredoxin| peroxidase) Length = 195 Score = 76.6 bits (187), Expect = 2e-14 Identities = 35/55 (63%), Positives = 44/55 (80%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 ++G AP+F A AV D +F ++ LSDY GK YV+LFFYP+DFTFVCPTEI AFS+ Sbjct: 5 MIGKPAPEFTATAVVDGDFKSISLSDYKGK-YVVLFFYPMDFTFVCPTEIIAFSE 58
>TDX1_BRUMA (P48822) Thioredoxin peroxidase 1 (EC 1.11.1.15) (Peroxiredoxin 1)| (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein 1) (Bm-TPx-1) Length = 229 Score = 76.6 bits (187), Expect = 2e-14 Identities = 36/53 (67%), Positives = 43/53 (81%) Frame = +2 Query: 260 NKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 NKAPDF+ AV + +F + + DY GK ++ILFFYPLDFTFVCPTEITAFSDR Sbjct: 37 NKAPDFSGTAVVNGDFKTISMKDYKGK-WLILFFYPLDFTFVCPTEITAFSDR 88
>TDX_ECHGR (Q8T6C4) Thioredoxin peroxidase (EC 1.11.1.15) (Peroxiredoxin)| (Thioredoxin-dependent peroxide reductase) (TPx-Eg) Length = 193 Score = 75.5 bits (184), Expect = 5e-14 Identities = 37/56 (66%), Positives = 43/56 (76%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 +VG AP F +A+ D E +V LSDY GK YVILFFYP+DFTFVCPTEI AF+DR Sbjct: 4 VVGKLAPSFTCKALVDGELKDVSLSDYRGK-YVILFFYPMDFTFVCPTEIIAFNDR 58
>PRDX1_HUMAN (Q06830) Peroxiredoxin-1 (EC 1.11.1.15) (Thioredoxin peroxidase 2)| (Thioredoxin-dependent peroxide reductase 2) (Proliferation-associated protein PAG) (Natural killer cell-enhancing factor A) (NKEF-A) Length = 199 Score = 75.1 bits (183), Expect = 7e-14 Identities = 38/58 (65%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = +2 Query: 254 VGNKAPDFAAEAVF-DQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +G+ AP+F A AV D +F ++ LSDY GK YV+ FFYPLDFTFVCPTEI AFSDR E Sbjct: 8 IGHPAPNFKATAVMPDGQFKDISLSDYKGK-YVVFFFYPLDFTFVCPTEIIAFSDRAE 64
>TDX_CYNPY (Q90384) Peroxiredoxin (EC 1.11.1.15) (Thioredoxin peroxidase)| (Thioredoxin-dependent peroxide reductase) (Animal blastomere protein, 25 kDa) (ABP-25) Length = 200 Score = 75.1 bits (183), Expect = 7e-14 Identities = 38/58 (65%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQ-EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +G AP+F A+AV EF ++KL+DY GK YV+ FFYPLDFTFVCPTEI AFSDR E Sbjct: 8 IGKPAPEFQAKAVMPGGEFKDIKLADYRGK-YVVFFFYPLDFTFVCPTEIIAFSDRAE 64
>PRDX1_RAT (Q63716) Peroxiredoxin-1 (EC 1.11.1.15) (Thioredoxin peroxidase 2)| (Thioredoxin-dependent peroxide reductase 2) (Heme-binding 23 kDa protein) (HBP23) Length = 199 Score = 74.7 bits (182), Expect = 9e-14 Identities = 38/58 (65%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +2 Query: 254 VGNKAPDFAAEAVF-DQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +G+ AP F A AV D +F ++ LSDY GK YV+ FFYPLDFTFVCPTEI AFSDR E Sbjct: 8 IGHPAPSFKATAVMPDGQFKDISLSDYKGK-YVVFFFYPLDFTFVCPTEIIAFSDRAE 64
>PRDX1_BOVIN (Q5E947) Peroxiredoxin-1 (EC 1.11.1.15)| Length = 199 Score = 74.7 bits (182), Expect = 9e-14 Identities = 37/58 (63%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = +2 Query: 254 VGNKAPDFAAEAVF-DQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +G++AP F A AV D +F ++ L+DY GK YV+ FFYPLDFTFVCPTEI AFSDR E Sbjct: 8 IGHRAPQFKATAVMPDGQFKDISLADYKGK-YVVFFFYPLDFTFVCPTEIIAFSDRAE 64
>TDX_ONCMY (Q91191) Peroxiredoxin (EC 1.11.1.15) (Thioredoxin peroxidase)| (Thioredoxin-dependent peroxide reductase) (Natural killer enhancement factor-like protein) (RBT-NKEF) Length = 200 Score = 72.0 bits (175), Expect = 6e-13 Identities = 36/58 (62%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +2 Query: 254 VGNKAPDFAAEAVF-DQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +G+ AP F A+AV D +F ++ +SDY GK YV+ FFYPLDFTFVCPTEI AFSD E Sbjct: 8 IGHLAPGFTAKAVMPDGQFKDISMSDYRGK-YVVFFFYPLDFTFVCPTEIIAFSDAAE 64
>PRDX1_MOUSE (P35700) Peroxiredoxin-1 (EC 1.11.1.15) (Thioredoxin peroxidase 2)| (Thioredoxin-dependent peroxide reductase 2) (Osteoblast-specific factor 3) (OSF-3) (Macrophage 23 kDa stress protein) Length = 199 Score = 71.2 bits (173), Expect = 9e-13 Identities = 36/56 (64%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 254 VGNKAPDFAAEAVF-DQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 +G AP+F A AV D +F ++ LS+Y GK YV+ FFYPLDFTFVCPTEI AFSDR Sbjct: 8 IGYPAPNFKATAVMPDGQFKDISLSEYKGK-YVVFFFYPLDFTFVCPTEIIAFSDR 62
>PRDX1_DROME (Q9V3P0) Peroxiredoxin 1 (EC 1.11.1.15) (Thioredoxin peroxidase)| (Cytosolic thioredoxin peroxidase) (DmTPx-1) (DPx-4783) Length = 194 Score = 71.2 bits (173), Expect = 9e-13 Identities = 35/57 (61%), Positives = 43/57 (75%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 +P + AP FA AV + F ++KLSDY GK Y++LFFYPLDFTFVCPTEI AFS+ Sbjct: 1 MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGK-YLVLFFYPLDFTFVCPTEIIAFSE 56
>PRDX3_BOVIN (P35705) Thioredoxin-dependent peroxide reductase, mitochondrial| precursor (EC 1.11.1.15) (Peroxiredoxin-3) (Antioxidant protein 1) (AOP-1) (SP-22 protein) Length = 257 Score = 70.9 bits (172), Expect = 1e-12 Identities = 35/60 (58%), Positives = 40/60 (66%) Frame = +2 Query: 239 YDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 Y P V AP F AV EF + L D+ GK Y++LFFYPLDFTFVCPTEI AFSD+ Sbjct: 61 YHAPAVTQHAPYFKGTAVVSGEFKEISLDDFKGK-YLVLFFYPLDFTFVCPTEIIAFSDK 119
>PRDX4_HUMAN (Q13162) Peroxiredoxin-4 (EC 1.11.1.15) (Prx-IV) (Thioredoxin| peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) (AOE37-2) Length = 271 Score = 69.7 bits (169), Expect = 3e-12 Identities = 34/57 (59%), Positives = 40/57 (70%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 + AP + AV D EF +KL+DY GK Y++ FFYPLDFTFVCPTEI AF DR E Sbjct: 81 ISKPAPYWEGTAVIDGEFKELKLTDYRGK-YLVFFFYPLDFTFVCPTEIIAFGDRLE 136
>PRDX3_MOUSE (P20108) Thioredoxin-dependent peroxide reductase, mitochondrial| precursor (EC 1.11.1.15) (Perioredoxin-3) (Antioxidant protein 1) (AOP-1) (MER5 protein) (PRX III) Length = 257 Score = 69.3 bits (168), Expect = 4e-12 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = +2 Query: 239 YDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 + P V AP F AV + EF + L D+ GK Y++LFFYPLDFTFVCPTEI AFSD+ Sbjct: 61 FHTPAVTQHAPYFKGTAVVNGEFKELSLDDFKGK-YLVLFFYPLDFTFVCPTEIVAFSDK 119
>PRDX3_HUMAN (P30048) Thioredoxin-dependent peroxide reductase, mitochondrial| precursor (EC 1.11.1.15) (Peroxiredoxin-3) (Antioxidant protein 1) (AOP-1) (MER5 protein homolog) (HBC189) (PRX III) Length = 256 Score = 69.3 bits (168), Expect = 4e-12 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +2 Query: 248 PLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 P V AP F AV + EF ++ L D+ GK Y++LFFYPLDFTFVCPTEI AFSD+ Sbjct: 63 PAVTQHAPYFKGTAVVNGEFKDLSLDDFKGK-YLVLFFYPLDFTFVCPTEIVAFSDK 118
>TDX_FASHE (P91883) Thioredoxin peroxidase (EC 1.11.1.15) (Peroxiredoxin)| (Thioredoxin-dependent peroxide reductase) (Thiol-specific antioxidant protein) Length = 194 Score = 68.6 bits (166), Expect = 6e-12 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +2 Query: 266 APDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 AP+F+ +AV +EF + LSDY GK +VIL FYPLDFTFVCPTEI A SD+ E Sbjct: 8 APNFSGQAVVGKEFETISLSDYKGK-WVILAFYPLDFTFVCPTEIIAISDQME 59
>R20K_CLOPA (P23161) Putative peroxiredoxin in rubredoxin operon (EC 1.11.1.15)| (Thioredoxin peroxidase) (ORF C) Length = 178 Score = 68.2 bits (165), Expect = 8e-12 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 2/60 (3%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFD--QEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 LVG AP+F +AV + F VKL DY GK ++++FFYPLDFTFVCPTEIT FS R E Sbjct: 4 LVGKPAPEFEMKAVKGDGRGFTEVKLGDYKGK-WLVMFFYPLDFTFVCPTEITGFSKRAE 62
>PRDX4_MOUSE (O08807) Peroxiredoxin-4 (EC 1.11.1.15) (Prx-IV) (Thioredoxin| peroxidase AO372) (Thioredoxin-dependent peroxide reductase A0372) (Antioxidant enzyme AOE372) Length = 274 Score = 67.8 bits (164), Expect = 1e-11 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 + AP + AV + EF +KL+DY GK Y++ FFYPLDFTFVCPTEI AF DR E Sbjct: 84 ISKPAPYWEGTAVINGEFKELKLTDYRGK-YLVFFFYPLDFTFVCPTEIIAFGDRIE 139
>TDX2_BRUMA (Q17172) Thioredoxin peroxidase 2 (EC 1.11.1.15) (Peroxiredoxin 2)| (Thioredoxin-dependent peroxide reductase 2) (Thiol-specific antioxidant protein 2) Length = 199 Score = 67.8 bits (164), Expect = 1e-11 Identities = 32/55 (58%), Positives = 39/55 (70%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 +G AP+F AV + +F + L + GK YV+L FYPLDFTFVCPTEI AFSDR Sbjct: 10 IGQPAPNFKTTAVVNGDFKEISLGQFKGK-YVVLLFYPLDFTFVCPTEIIAFSDR 63
>PRDX4_BOVIN (Q9BGI2) Peroxiredoxin-4 (EC 1.11.1.15) (Prx-IV)| Length = 274 Score = 67.0 bits (162), Expect = 2e-11 Identities = 32/55 (58%), Positives = 39/55 (70%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 + AP + AV + EF +KL+DY GK Y++ FFYPLDFTFVCPTEI AF DR Sbjct: 84 ISKPAPYWEGTAVINGEFKELKLTDYRGK-YLVFFFYPLDFTFVCPTEIIAFGDR 137
>YCF42_ODOSI (P49537) Putative peroxiredoxin ycf42 (EC 1.11.1.15) (Thioredoxin| reductase) Length = 204 Score = 63.5 bits (153), Expect = 2e-10 Identities = 28/59 (47%), Positives = 38/59 (64%) Frame = +2 Query: 242 DLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 + P +G P+F V+ + ++LSDY GKKYVILFFYP +FT + PTE+ SDR Sbjct: 3 NFPKIGKTPPNFLTIGVYKKRLGKIRLSDYRGKKYVILFFYPANFTAISPTELMLLSDR 61
>TDX1_CAEEL (Q21824) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| peroxidase) (Thioredoxin-dependent peroxide reductase) (Thiol-specific antioxidant protein) Length = 226 Score = 61.2 bits (147), Expect = 1e-09 Identities = 29/53 (54%), Positives = 36/53 (67%) Frame = +2 Query: 260 NKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 N P F AV D +F + DY GK ++++FFYPLDFTFVCPTEI A+ DR Sbjct: 37 NTVPAFKGTAVVDGDFKVISDQDYKGK-WLVMFFYPLDFTFVCPTEIIAYGDR 88
>TSAA_HELPJ (P56876) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| reductase) (26 kDa antigen) Length = 198 Score = 58.5 bits (140), Expect = 6e-09 Identities = 32/58 (55%), Positives = 37/58 (63%), Gaps = 2/58 (3%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFIN--VKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 LV APDF A AV ++ +LS +GK VILFF+P DFTFVCPTEI AF R Sbjct: 2 LVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKR 59
>TSAA_HELPY (P21762) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| reductase) (26 kDa antigen) Length = 198 Score = 57.0 bits (136), Expect = 2e-08 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 2/58 (3%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFIN--VKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 LV APDF A AV ++ +LS +GK ILFF+P DFTFVCPTEI AF R Sbjct: 2 LVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKR 59
>TDX_TRYBR (Q26695) Thioredoxin peroxidase (EC 1.11.1.15) (Peroxiredoxin)| (Thioredoxin-dependent peroxide reductase) (Thiol-specific antioxidant protein) Length = 199 Score = 57.0 bits (136), Expect = 2e-08 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQ-EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 + + AP F A+ F V L+ Y GK +V+LFFYPLDFTFVCPTEI FSDR Sbjct: 8 LNHPAPHFNEVALMPNGTFKKVDLASYRGK-WVVLFFYPLDFTFVCPTEICQFSDR 62
>TSA1_YEAST (P34760) Peroxiredoxin TSA1 (EC 1.11.1.15) (Thioredoxin peroxidase)| (Cytoplasmic thiol peroxidase 1) (cTPx 1) (Thiol-specific antioxidant protein 1) (PRP) Length = 195 Score = 56.2 bits (134), Expect = 3e-08 Identities = 31/54 (57%), Positives = 34/54 (62%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 V +AP F AV D F V L Y GK YV+L F PL FTFVCPTEI AFS+ Sbjct: 4 VQKQAPTFKKTAVVDGVFDEVSLDKYKGK-YVVLAFIPLAFTFVCPTEIIAFSE 56
>TSA2_YEAST (Q04120) Peroxiredoxin TSA2 (EC 1.11.1.15) (Thioredoxin peroxidase| 2) (Cytoplasmic thiol peroxidase 2) (cTPx 2) (Thiol-specific antioxidant protein 2) Length = 195 Score = 55.8 bits (133), Expect = 4e-08 Identities = 30/54 (55%), Positives = 34/54 (62%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 V +AP F AV D F + L Y GK YV+L F PL F+FVCPTEI AFSD Sbjct: 4 VQKQAPPFKKTAVVDGIFEEISLEKYKGK-YVVLAFVPLAFSFVCPTEIVAFSD 56
>TSA1_CANAL (Q9Y7F0) Peroxiredoxin TSA1 (EC 1.11.1.15) (Thioredoxin peroxidase)| (Thiol-specific antioxidant protein) Length = 196 Score = 53.9 bits (128), Expect = 2e-07 Identities = 29/56 (51%), Positives = 35/56 (62%) Frame = +2 Query: 248 PLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 P+V AP F AV D F V L Y GK +V+L F PL FTFVCP+EI A+S+ Sbjct: 3 PVVQQPAPSFKKTAVVDGVFEEVTLEQYKGK-WVLLAFIPLAFTFVCPSEIIAYSE 57
>CR29_ENTHI (P19476) Putative peroxiredoxin (EC 1.11.1.15) (Thioredoxin| peroxidase) (29 kDa cysteine-rich surface antigen) Length = 233 Score = 52.8 bits (125), Expect = 3e-07 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFIN-VKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 +G +AP+F A A I + +++Y GK YV+L FYPLD+TFVCPTE+ +S+ Sbjct: 43 IGKEAPEFKAPAYCPCGSIKEIDINEYRGK-YVVLLFYPLDWTFVCPTEMIGYSE 96
>TSAA_BUCAP (Q8K9W0) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| reductase) Length = 198 Score = 52.4 bits (124), Expect = 5e-07 Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFI--NVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 + LV KAP+F A A+ I N L Y + +LFF+P+DFTFVCP+EI F+ Sbjct: 1 MTLVTQKAPNFIAPAILKNGKIMNNFDLKKYSNGQITVLFFWPMDFTFVCPSEIIEFNKT 60 Query: 419 HE 424 E Sbjct: 61 FE 62
>TDXH2_THETN (Q8R844) Probable peroxiredoxin 2 (EC 1.11.1.15)| Length = 221 Score = 52.0 bits (123), Expect = 6e-07 Identities = 29/56 (51%), Positives = 36/56 (64%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 LP +G APDF A + F +KLSDY GK +V+LF +P DFT VC TE AF+ Sbjct: 14 LPQIGAPAPDFKANSTFGP----IKLSDYRGK-WVVLFSHPGDFTPVCTTEFIAFT 64
>PRDX2_PIG (P52552) Peroxiredoxin-2 (EC 1.11.1.15) (Thioredoxin peroxidase 1)| (Thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant protein) (TSA) (Fragment) Length = 127 Score = 50.1 bits (118), Expect = 2e-06 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +2 Query: 353 LFFYPLDFTFVCPTEITAFSDRHE 424 LFFYPLDFTFVCPTEI AFSDR E Sbjct: 1 LFFYPLDFTFVCPTEIIAFSDRAE 24
>TSAA_BUCBP (Q89AS1) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| reductase) Length = 199 Score = 50.1 bits (118), Expect = 2e-06 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFI--NVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 LV APDF A A+ I N ++ + ILFF+P+DFTFVCP+EI AF+ Sbjct: 3 LVTYPAPDFTASAISCNGDIINNFNFKEFTNNQTSILFFWPMDFTFVCPSEIIAFN 58
>AHPC_SALTY (P0A251) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) (Alkyl hydroperoxide reductase protein C22) Length = 186 Score = 49.7 bits (117), Expect = 3e-06 Identities = 25/58 (43%), Positives = 34/58 (58%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 L+ K F +A + EFI V D G+ + + FFYP DFTFVCPTE+ +D +E Sbjct: 2 LINTKIKPFKNQAFKNGEFIEVTEKDTEGR-WSVFFFYPADFTFVCPTELGDVADHYE 58
>AHPC_SALTI (P0A252) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) (Alkyl hydroperoxide reductase protein C22) Length = 186 Score = 49.7 bits (117), Expect = 3e-06 Identities = 25/58 (43%), Positives = 34/58 (58%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 L+ K F +A + EFI V D G+ + + FFYP DFTFVCPTE+ +D +E Sbjct: 2 LINTKIKPFKNQAFKNGEFIEVTEKDTEGR-WSVFFFYPADFTFVCPTELGDVADHYE 58
>TSAA_BUCAI (P57279) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| reductase) Length = 197 Score = 49.3 bits (116), Expect = 4e-06 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFI--NVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 421 LV AP+F A A+ I L Y + +LFF+P+DFTFVCP+EI F+ H Sbjct: 3 LVTQNAPNFIAPAILKNNQIVEQFDLKKYSNGQSTVLFFWPMDFTFVCPSEIIEFNKLH 61
>AHPC_SHIFL (P0AE11) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) (Alkyl hydroperoxide reductase protein C22) (SCRP-23) (Sulfate starvation-induced protein 8) (SSI8) Length = 186 Score = 49.3 bits (116), Expect = 4e-06 Identities = 24/58 (41%), Positives = 34/58 (58%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 L+ K F +A + EFI + D G+ + + FFYP DFTFVCPTE+ +D +E Sbjct: 2 LINTKIKPFKNQAFKNGEFIEITEKDTEGR-WSVFFFYPADFTFVCPTELGDVADHYE 58
>AHPC_ECOLI (P0AE08) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) (Alkyl hydroperoxide reductase protein C22) (SCRP-23) (Sulfate starvation-induced protein 8) (SSI8) Length = 186 Score = 49.3 bits (116), Expect = 4e-06 Identities = 24/58 (41%), Positives = 34/58 (58%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 L+ K F +A + EFI + D G+ + + FFYP DFTFVCPTE+ +D +E Sbjct: 2 LINTKIKPFKNQAFKNGEFIEITEKDTEGR-WSVFFFYPADFTFVCPTELGDVADHYE 58
>AHPC_ECOL6 (P0AE09) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) (Alkyl hydroperoxide reductase protein C22) (SCRP-23) (Sulfate starvation-induced protein 8) (SSI8) Length = 186 Score = 49.3 bits (116), Expect = 4e-06 Identities = 24/58 (41%), Positives = 34/58 (58%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 L+ K F +A + EFI + D G+ + + FFYP DFTFVCPTE+ +D +E Sbjct: 2 LINTKIKPFKNQAFKNGEFIEITEKDTEGR-WSVFFFYPADFTFVCPTELGDVADHYE 58
>AHPC_ECO57 (P0AE10) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) (Alkyl hydroperoxide reductase protein C22) (SCRP-23) (Sulfate starvation-induced protein 8) (SSI8) Length = 186 Score = 49.3 bits (116), Expect = 4e-06 Identities = 24/58 (41%), Positives = 34/58 (58%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 L+ K F +A + EFI + D G+ + + FFYP DFTFVCPTE+ +D +E Sbjct: 2 LINTKIKPFKNQAFKNGEFIEITEKDTEGR-WSVFFFYPADFTFVCPTELGDVADHYE 58
>AHPC_RHORU (P72314) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) (Alkyl hydroperoxide reductase protein C22) (Fragment) Length = 68 Score = 48.9 bits (115), Expect = 5e-06 Identities = 22/59 (37%), Positives = 37/59 (62%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 421 + L+G++ F A+A +F+ V D + K+ ++FFYP DFTFVCPTE+ ++ + Sbjct: 1 MSLIGSEVKPFKADAFKAGKFVTVT-DDTLKGKWSVVFFYPADFTFVCPTELEDLAENY 58
>TDXH_AQUAE (O67024) Probable peroxiredoxin (EC 1.11.1.15)| Length = 222 Score = 46.6 bits (109), Expect = 3e-05 Identities = 25/60 (41%), Positives = 33/60 (55%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 LP +G AP F A+ F VK D ++V+LF +P DFT VC TE AF+ +E Sbjct: 6 LPRLGEPAPAFEAQTTFGP----VKFPDDFKGQWVVLFSHPADFTPVCTTEFVAFAKNYE 61
>TDXH_THEVO (Q979N7) Probable peroxiredoxin (EC 1.11.1.15)| Length = 203 Score = 46.2 bits (108), Expect = 3e-05 Identities = 26/58 (44%), Positives = 36/58 (62%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 ++G KAPDF + LS+Y GK +V+LF +P DFT VC TE AF++R+E Sbjct: 4 VLGQKAPDFTVNTSKGP----ITLSNYRGK-WVLLFSHPGDFTPVCTTEFIAFTERYE 56
>TDXH2_SULTO (Q96XS5) Probable peroxiredoxin 2 (EC 1.11.1.15)| Length = 212 Score = 45.4 bits (106), Expect = 6e-05 Identities = 23/63 (36%), Positives = 35/63 (55%) Frame = +2 Query: 236 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 E +PL+G K P+ + +KL DY K+ +LF +P DFT VC TE +F+ Sbjct: 3 EEKIPLIGEKFPEMEVITTHGK----IKLPDYYQGKWFVLFSHPGDFTPVCTTEFYSFAK 58 Query: 416 RHE 424 ++E Sbjct: 59 KYE 61
>AHPC_BACSU (P80239) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) (Alkyl hydroperoxide reductase protein C22) (General stress protein 22) Length = 187 Score = 45.4 bits (106), Expect = 6e-05 Identities = 22/59 (37%), Positives = 36/59 (61%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 421 + L+G + F A+A + EFI+V D G+ + + FYP DF+FVCPTE+ +++ Sbjct: 1 MSLIGKEVLPFEAKAFKNGEFIDVTNEDLKGQ-WSVFCFYPADFSFVCPTELEDLQEQY 58
>TDXH_METMA (Q8PYP6) Probable peroxiredoxin (EC 1.11.1.15)| Length = 219 Score = 44.7 bits (104), Expect = 1e-04 Identities = 28/60 (46%), Positives = 34/60 (56%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +PL+G+ AP F A V Q I DY GK +VILF +P DFT VC TE F+ E Sbjct: 1 MPLIGDDAPSFTA--VTTQGIIKFP-DDYKGK-WVILFSHPADFTPVCTTEFMTFASMQE 56
>TDXH2_THEAC (Q9HJL3) Probable peroxiredoxin 2 (EC 1.11.1.15)| Length = 199 Score = 44.3 bits (103), Expect = 1e-04 Identities = 26/57 (45%), Positives = 34/57 (59%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +G KAPDF V LS Y GK +V+LF +P DFT VC TE AF++R++ Sbjct: 1 MGQKAPDFTVNTSKGP----VTLSSYRGK-WVLLFSHPGDFTPVCTTEFIAFTERYK 52
>TDXH2_PICTO (Q6L140) Probable peroxiredoxin 2 (EC 1.11.1.15)| Length = 201 Score = 43.5 bits (101), Expect = 2e-04 Identities = 24/56 (42%), Positives = 32/56 (57%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 421 +G +APDF A + LSDY K+V+LF +P DFT +C TE FS R+ Sbjct: 5 LGKRAPDFTANTTRGV----ISLSDY-KNKWVLLFSHPADFTPICTTEFIEFSRRY 55
>TDXH1_PICTO (Q6L240) Probable peroxiredoxin 1 (EC 1.11.1.15)| Length = 227 Score = 43.5 bits (101), Expect = 2e-04 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +2 Query: 236 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 E +PL+G K P+ N+KL D K+ +LF +P DFT VC TE +F+ Sbjct: 2 EGKMPLIGEKFPEMEVVTNLG----NIKLPDDFKGKWFVLFSHPGDFTPVCTTEFFSFAK 57 Query: 416 RHE 424 H+ Sbjct: 58 HHD 60
>REHY_HORVU (P52572) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| peroxidase) (Rehydrin homolog) (B15C) Length = 218 Score = 42.7 bits (99), Expect = 4e-04 Identities = 19/54 (35%), Positives = 33/54 (61%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 +G+ P+ ++ + +++ DY+G YVILF +P DFT VC TE+ A ++ Sbjct: 6 IGDTVPNLELDSTHGK----IRIHDYVGNGYVILFSHPGDFTPVCTTELAAMAN 55
>PRDX6_BOVIN (O77834) Peroxiredoxin-6 (EC 1.11.1.15) (Antioxidant protein 2)| (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) (PHGPx) (Ciliary Length = 223 Score = 42.4 bits (98), Expect = 5e-04 Identities = 20/50 (40%), Positives = 31/50 (62%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEI 400 L+G++AP+F A + ++ DY+G + ILF +P DFT VC TE+ Sbjct: 5 LLGDEAPNFEANTTIGR----IRFHDYLGDSWGILFSHPRDFTPVCTTEL 50
>PRX1_YEAST (P34227) Mitochondrial peroxiredoxin PRX1 (EC 1.11.1.15)| (Thioredoxin reductase) (1-Cys Prx) (Mitochondrial thiol peroxidase) (mTPx) Length = 261 Score = 42.4 bits (98), Expect = 5e-04 Identities = 19/53 (35%), Positives = 32/53 (60%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 + + AP+F A+ + + DY+G + +LF +P DFT VC TE++AF+ Sbjct: 51 INSDAPNFDADTTVGK----INFYDYLGDSWGVLFSHPADFTPVCTTEVSAFA 99
>TDXH1_THEAC (Q9HKX0) Probable peroxiredoxin 1 (EC 1.11.1.15)| Length = 233 Score = 42.0 bits (97), Expect = 6e-04 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +2 Query: 236 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 E PL+G K P+ E ++KL D ++ +LF +P DFT VC TE +F+ Sbjct: 4 ENKFPLIGEKFPEMTVETTHG----SMKLPDQYKGRWFMLFSHPGDFTPVCTTEFYSFAR 59 Query: 416 RHE 424 R E Sbjct: 60 RFE 62
>TDXH_METTH (O26262) Probable peroxiredoxin (EC 1.11.1.15)| Length = 209 Score = 41.6 bits (96), Expect = 8e-04 Identities = 21/57 (36%), Positives = 31/57 (54%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 +PL+G+K P+ + ++L D K+ ILF +P DFT VC TE AF + Sbjct: 1 MPLIGDKFPEMEVQTTHGP----MELPDEFEGKWFILFSHPADFTPVCTTEFVAFQE 53
>TSA_ONCVO (P52570) Putative peroxiredoxin (EC 1.11.1.15) (Thioredoxin| peroxidase) (Thiol-specific antioxidant) Length = 232 Score = 41.6 bits (96), Expect = 8e-04 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = +2 Query: 257 GNKAPDFAAEAVFDQEFINVKLSDYIGK-KYVILFFYPLDFTFVCPTEI 400 GNK PDF AE ++ FI+ D+IGK + ILF +P DFT VC TE+ Sbjct: 8 GNKFPDFQAET--NEGFIS-SFYDWIGKDSWAILFSHPRDFTPVCTTEL 53
>TDXH_METJA (Q58146) Probable peroxiredoxin (EC 1.11.1.15)| Length = 217 Score = 40.8 bits (94), Expect = 0.001 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKK--YVILFFYPLDFTFVCPTEITAFSDR 418 +P++G K P+ + +KL DY +K + +LF +P DFT VC TE F R Sbjct: 1 MPVIGEKFPEVEVKTTHGA----IKLPDYYVEKGKWFVLFSHPADFTPVCTTEFVGFQKR 56 Query: 419 HE 424 ++ Sbjct: 57 YD 58
>REHY_ORYSA (P52573) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| peroxidase) (RAB24 protein) Length = 220 Score = 40.8 bits (94), Expect = 0.001 Identities = 18/53 (33%), Positives = 32/53 (60%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 +G+ P+ ++ + +++ D++G YVILF +P DFT VC TE+ A + Sbjct: 6 IGDTVPNLELDSTHGK----IRIHDFVGDTYVILFSHPGDFTPVCTTELAAMA 54
>PRDX6_RAT (O35244) Peroxiredoxin-6 (EC 1.11.1.15) (Antioxidant protein 2)| (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) (Thiol-specific an Length = 223 Score = 40.8 bits (94), Expect = 0.001 Identities = 19/50 (38%), Positives = 31/50 (62%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEI 400 L+G++AP+F A +++ D++G + ILF +P DFT VC TE+ Sbjct: 5 LLGDEAPNFEANTTIG----HIRFHDFLGDSWGILFSHPRDFTPVCTTEL 50
>PRDX6_MOUSE (O08709) Peroxiredoxin-6 (EC 1.11.1.15) (Antioxidant protein 2)| (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) Length = 223 Score = 40.8 bits (94), Expect = 0.001 Identities = 19/50 (38%), Positives = 31/50 (62%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEI 400 L+G++AP+F A + ++ D++G + ILF +P DFT VC TE+ Sbjct: 5 LLGDEAPNFEANTTIGR----IRFHDFLGDSWGILFSHPRDFTPVCTTEL 50
>TDXH_AERPE (Q9Y9L0) Probable peroxiredoxin (EC 1.11.1.15)| Length = 250 Score = 40.8 bits (94), Expect = 0.001 Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSD-YIGK-KYVILFFYPLDFTFVCPTEITAFSDR 418 +PL+G + P+ E D I KL D Y+ + K+ +LF +P DFT VC TE +F+ R Sbjct: 5 IPLIGERFPEM--EVTTDHGVI--KLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARR 60 Query: 419 HE 424 +E Sbjct: 61 YE 62
>1CPX_DIRIM (O17433) 1-Cys peroxiredoxin (EC 1.11.1.15) (Thioredoxin| peroxidase) (1-CysPxn) Length = 235 Score = 40.4 bits (93), Expect = 0.002 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGK-KYVILFFYPLDFTFVCPTEI 400 L+G+K PDF AE ++ FI D+IGK + ILF +P DFT VC TE+ Sbjct: 6 LLGDKFPDFRAET--NEGFIP-SFYDWIGKDSWAILFSHPRDFTPVCTTEL 53
>TDXH_ARCFU (O29969) Probable peroxiredoxin (EC 1.11.1.15)| Length = 215 Score = 40.0 bits (92), Expect = 0.002 Identities = 20/59 (33%), Positives = 32/59 (54%) Frame = +2 Query: 248 PLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 PL+G+ P+ + +KL + K+ +LF +P DFT VC TE AF +R++ Sbjct: 3 PLLGDNFPEIEVVTTHGR----MKLPEAFKGKWFVLFSHPADFTPVCTTEFVAFQNRYD 57
>REHY_BROSE (P52571) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| peroxidase) (Rehydrin homolog) (Dormancy-associated protein PBS128) (Fragment) Length = 202 Score = 39.7 bits (91), Expect = 0.003 Identities = 16/34 (47%), Positives = 24/34 (70%) Frame = +2 Query: 314 VKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 +++ DY+ YVILF +P DFT VC TE+ A ++ Sbjct: 6 IRIHDYVANGYVILFSHPGDFTPVCTTELAAMAN 39
>TDXH_SULSO (P95895) Probable peroxiredoxin (EC 1.11.1.15)| Length = 215 Score = 39.7 bits (91), Expect = 0.003 Identities = 22/63 (34%), Positives = 36/63 (57%) Frame = +2 Query: 236 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 E +PL+G + P+ E + Q +KL D ++ +LF +P DFT VC TE +F+ Sbjct: 3 EERIPLIGERFPEM--EVITTQG--RIKLPDDYKGRWFVLFSHPGDFTPVCTTEFYSFAK 58 Query: 416 RHE 424 ++E Sbjct: 59 KYE 61
>YNDH_BACYN (P26830) Putative peroxiredoxin in NDH 5' region (EC 1.11.1.15)| (Thioredoxin reductase) (Fragment) Length = 168 Score = 39.3 bits (90), Expect = 0.004 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = +2 Query: 302 EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEI 400 EFI V + G+ + +L FYP DFTFVCPTE+ Sbjct: 1 EFIEVSEESFKGQ-WSVLCFYPADFTFVCPTEL 32
>PRDX6_HUMAN (P30041) Peroxiredoxin-6 (EC 1.11.1.15) (Antioxidant protein 2)| (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) (24 kDa protein) Length = 223 Score = 39.3 bits (90), Expect = 0.004 Identities = 19/50 (38%), Positives = 30/50 (60%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEI 400 L+G+ AP+F A + ++ D++G + ILF +P DFT VC TE+ Sbjct: 5 LLGDVAPNFEANTTVGR----IRFHDFLGDSWGILFSHPRDFTPVCTTEL 50
>TDXH_THEMA (Q9WZR4) Probable peroxiredoxin (EC 1.11.1.15)| Length = 215 Score = 38.9 bits (89), Expect = 0.005 Identities = 20/60 (33%), Positives = 31/60 (51%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +PL+G + P + ++ L D K+ +LF +P DFT VC TE AF R++ Sbjct: 5 IPLIGEEFPRVEVKTTHGKKV----LPDDFRGKWFVLFSHPADFTPVCTTEFVAFQKRYD 60
>REHY_ARATH (O04005) Peroxiredoxin (EC 1.11.1.15) (Thioredoxin peroxidase)| (Rehydrin homolog) Length = 216 Score = 38.5 bits (88), Expect = 0.007 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 +G+ P+ E D+ KL DY + +LF +P DFT VC TE+ A + Sbjct: 6 LGDTVPNLEVETTHDK----FKLHDYFANSWTVLFSHPGDFTPVCTTELGAMA 54
>TPX_LEPIN (Q8F7T2) Probable thiol peroxidase (EC 1.11.1.-)| Length = 171 Score = 38.5 bits (88), Expect = 0.007 Identities = 24/64 (37%), Positives = 33/64 (51%) Frame = +2 Query: 236 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 E +P G+KAPDF A Q+ L DY GK +++ LD T VC E AF++ Sbjct: 14 EGKIPSPGDKAPDFKA---IKQDLSEFSLKDYAGKVKILVAVPSLD-TSVCALETKAFNE 69 Query: 416 RHEG 427 + G Sbjct: 70 KAAG 73
>TPX_LEPIC (Q72NR4) Probable thiol peroxidase (EC 1.11.1.-)| Length = 171 Score = 38.5 bits (88), Expect = 0.007 Identities = 24/64 (37%), Positives = 33/64 (51%) Frame = +2 Query: 236 EYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 E +P G+KAPDF A Q+ L DY GK +++ LD T VC E AF++ Sbjct: 14 EGKIPSPGDKAPDFKA---IKQDLSEFSLKDYAGKVKILVAVPSLD-TSVCALETKAFNE 69 Query: 416 RHEG 427 + G Sbjct: 70 KAAG 73
>TDXH_METTM (Q57109) Probable peroxiredoxin (EC 1.11.1.15)| Length = 209 Score = 38.5 bits (88), Expect = 0.007 Identities = 20/57 (35%), Positives = 30/57 (52%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 +PL+G+K P+ + +KL ++ ILF +P DFT VC TE AF + Sbjct: 1 MPLIGDKFPEMEVQTTHGL----MKLPAEFKGRWFILFSHPADFTPVCTTEFVAFQE 53
>AHPC_STAAW (P0A0B6) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) Length = 189 Score = 37.7 bits (86), Expect = 0.012 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFD---QEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 + L+ + F A+A FD +F V D G + ++ FYP DF+FVCPTE+ + Sbjct: 1 MSLINKEILPFTAQA-FDPKKDQFKEVTQEDLKGS-WSVVCFYPADFSFVCPTELEDLQN 58 Query: 416 RHE 424 ++E Sbjct: 59 QYE 61
>AHPC_STAAU (P0A0B7) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) Length = 189 Score = 37.7 bits (86), Expect = 0.012 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFD---QEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 + L+ + F A+A FD +F V D G + ++ FYP DF+FVCPTE+ + Sbjct: 1 MSLINKEILPFTAQA-FDPKKDQFKEVTQEDLKGS-WSVVCFYPADFSFVCPTELEDLQN 58 Query: 416 RHE 424 ++E Sbjct: 59 QYE 61
>AHPC_STAAS (Q6GC91) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) Length = 189 Score = 37.7 bits (86), Expect = 0.012 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFD---QEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 + L+ + F A+A FD +F V D G + ++ FYP DF+FVCPTE+ + Sbjct: 1 MSLINKEILPFTAQA-FDPKKDQFKEVTQEDLKGS-WSVVCFYPADFSFVCPTELEDLQN 58 Query: 416 RHE 424 ++E Sbjct: 59 QYE 61
>AHPC_STAAR (Q6GJR7) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) Length = 189 Score = 37.7 bits (86), Expect = 0.012 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFD---QEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 + L+ + F A+A FD +F V D G + ++ FYP DF+FVCPTE+ + Sbjct: 1 MSLINKEILPFTAQA-FDPKKDQFKEVTQEDLKGS-WSVVCFYPADFSFVCPTELEDLQN 58 Query: 416 RHE 424 ++E Sbjct: 59 QYE 61
>AHPC_STAAN (P99074) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) Length = 189 Score = 37.7 bits (86), Expect = 0.012 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFD---QEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 + L+ + F A+A FD +F V D G + ++ FYP DF+FVCPTE+ + Sbjct: 1 MSLINKEILPFTAQA-FDPKKDQFKEVTQEDLKGS-WSVVCFYPADFSFVCPTELEDLQN 58 Query: 416 RHE 424 ++E Sbjct: 59 QYE 61
>AHPC_STAAM (P0A0B5) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) Length = 189 Score = 37.7 bits (86), Expect = 0.012 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFD---QEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 + L+ + F A+A FD +F V D G + ++ FYP DF+FVCPTE+ + Sbjct: 1 MSLINKEILPFTAQA-FDPKKDQFKEVTQEDLKGS-WSVVCFYPADFSFVCPTELEDLQN 58 Query: 416 RHE 424 ++E Sbjct: 59 QYE 61
>AHPC_STAAC (Q5HIR5) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) Length = 189 Score = 37.7 bits (86), Expect = 0.012 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFD---QEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 + L+ + F A+A FD +F V D G + ++ FYP DF+FVCPTE+ + Sbjct: 1 MSLINKEILPFTAQA-FDPKKDQFKEVTQEDLKGS-WSVVCFYPADFSFVCPTELEDLQN 58 Query: 416 RHE 424 ++E Sbjct: 59 QYE 61
>TDXH1_SULTO (Q974S8) Probable peroxiredoxin 1 (EC 1.11.1.15)| Length = 215 Score = 37.7 bits (86), Expect = 0.012 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = +2 Query: 326 DYIGK-KYVILFFYPLDFTFVCPTEITAFSDRHE 424 D GK K++ LF +P DFT VC TE AFS ++E Sbjct: 25 DIFGKGKWLFLFAHPADFTPVCTTEFVAFSQKYE 58
>AHPC_STAES (Q8CMQ2) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) Length = 189 Score = 37.0 bits (84), Expect = 0.020 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQ--EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 + L+ + F A+A + EF V D+ G V+ F YP DF+FVCPTE+ ++ Sbjct: 1 MSLINKEILPFTAQAYDPKKDEFKEVTQEDFKGSWNVVCF-YPADFSFVCPTELEDLQNQ 59 Query: 419 H 421 + Sbjct: 60 Y 60
>AHPC_STAEQ (Q5HRY1) Alkyl hydroperoxide reductase subunit C (EC 1.11.1.15)| (Peroxiredoxin) (Thioredoxin peroxidase) Length = 189 Score = 37.0 bits (84), Expect = 0.020 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQ--EFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDR 418 + L+ + F A+A + EF V D+ G V+ F YP DF+FVCPTE+ ++ Sbjct: 1 MSLINKEILPFTAQAYDPKKDEFKEVTQEDFKGSWNVVCF-YPADFSFVCPTELEDLQNQ 59 Query: 419 H 421 + Sbjct: 60 Y 60
>BCP_HAEIN (P44411) Putative peroxiredoxin bcp (EC 1.11.1.15) (Thioredoxin| reductase) (Bacterioferritin comigratory protein homolog) Length = 155 Score = 36.6 bits (83), Expect = 0.026 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD 415 VGN+AP F + +Q+ V LSD+ GKK V+++FYP T C T+ D Sbjct: 6 VGNQAPAFT---LLNQQEKFVSLSDFRGKK-VLIYFYPKALTPGCTTQACGLRD 55
>TDXH_PYRHO (O58966) Probable peroxiredoxin (EC 1.11.1.15)| Length = 216 Score = 35.8 bits (81), Expect = 0.044 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGK--KYVILFFYPLDFTFVCPTEITAFSDRHE 424 ++G K P+ + +KL DY K K+ ILF +P DFT VC TE R E Sbjct: 3 VIGEKFPEVEVKTTHGV----IKLPDYFTKQGKWFILFSHPADFTPVCTTEFYGMQKRVE 58
>TDXH_NANEQ (Q74NC6) Probable peroxiredoxin (EC 1.11.1.15)| Length = 222 Score = 35.8 bits (81), Expect = 0.044 Identities = 17/58 (29%), Positives = 31/58 (53%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 ++G K P+ + + ++L D+ K+ +LF +P DFT VC TE F+ ++ Sbjct: 3 VLGQKFPEVEVQTTHGR----MRLPDHYRGKWFVLFSHPADFTPVCTTEFVEFARNYD 56
>BCP_HELPY (P55979) Putative peroxiredoxin bcp (EC 1.11.1.15) (Thioredoxin| reductase) (Bacterioferritin comigratory protein homolog) Length = 152 Score = 35.4 bits (80), Expect = 0.058 Identities = 21/53 (39%), Positives = 29/53 (54%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 VG APDF + + + + + L D + KK V+L+FYP D T C E FS Sbjct: 6 VGQLAPDFRLK---NSDGVEISLKDLLHKK-VVLYFYPKDNTPGCTLEAKDFS 54
>BCP_HELPJ (Q9ZMU4) Putative peroxiredoxin bcp (EC 1.11.1.15) (Thioredoxin| reductase) (Bacterioferritin comigratory protein homolog) Length = 152 Score = 35.4 bits (80), Expect = 0.058 Identities = 21/53 (39%), Positives = 29/53 (54%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 VG APDF + + + + + L D + KK V+L+FYP D T C E FS Sbjct: 6 VGQLAPDFRLK---NSDGVEISLKDLLHKK-VVLYFYPKDNTPGCTLEAKDFS 54
>TDXH_PYRKO (Q5JF30) Probable peroxiredoxin (EC 1.11.1.15)| Length = 216 Score = 35.4 bits (80), Expect = 0.058 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGK--KYVILFFYPLDFTFVCPTEITAFSDR 418 ++G K P+ + +KL DY + K+ +LF +P DFT VC TE A R Sbjct: 3 VIGEKFPEVEVKTTHGV----IKLPDYFAEQGKWFVLFSHPADFTPVCTTEFYAMQKR 56
>TDXH_CHLTE (Q8KBN8) Probable peroxiredoxin (EC 1.11.1.15)| Length = 211 Score = 34.7 bits (78), Expect = 0.098 Identities = 20/60 (33%), Positives = 28/60 (46%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 +PL+G+ P+ + I L + +LF +P DFT VC TE AF R E Sbjct: 1 MPLLGDDFPELKVQTTHGPMNIPGDLKG----SWFVLFSHPADFTPVCTTEFVAFQQRVE 56
>TPX_COREF (Q8FQH8) Probable thiol peroxidase (EC 1.11.1.-)| Length = 165 Score = 34.7 bits (78), Expect = 0.098 Identities = 23/62 (37%), Positives = 30/62 (48%) Frame = +2 Query: 242 DLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 421 +LP VG+ PDF V D V LSD GKK V+ F +D T +C + F+ Sbjct: 16 ELPAVGDTLPDFT---VVDTNLGEVSLSDLKGKKLVLNIFPSVD-TGLCAESVRRFNAEA 71 Query: 422 EG 427 G Sbjct: 72 AG 73
>TDXH_TREDE (Q73RS4) Probable peroxiredoxin (EC 1.11.1.15)| Length = 208 Score = 34.3 bits (77), Expect = 0.13 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAF 409 +PL+G+ P A +KL + + +LF +P DFT VC TE AF Sbjct: 1 MPLLGDDFPQLAVSTTHGP----MKLPCDLKGSWFVLFSHPADFTPVCTTEFVAF 51
>TDXH1_THETN (Q8RCY5) Probable peroxiredoxin 1 (EC 1.11.1.15)| Length = 215 Score = 33.9 bits (76), Expect = 0.17 Identities = 22/60 (36%), Positives = 29/60 (48%) Frame = +2 Query: 245 LPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 + L+G K P V + DY GK +V LF +P DFT VC TE F+ + E Sbjct: 1 MKLLGEKFPSME---VMTTHGVKRLPEDYAGKWFV-LFSHPADFTPVCTTEFVEFARKAE 56
>BCP_BUCAP (Q9ZHF0) Putative peroxiredoxin bcp (EC 1.11.1.15) (Thioredoxin| reductase) (Bacterioferritin comigratory protein) Length = 158 Score = 33.9 bits (76), Expect = 0.17 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = +2 Query: 257 GNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHE 424 G+ AP F D+ ++KLSD++GKK V+++FYP T C + D E Sbjct: 7 GDIAPKFILPNCIDK---SIKLSDFLGKK-VLVYFYPKAMTPGCTVQACNIRDNLE 58
>TDXH_PYRAB (Q9UZV4) Probable peroxiredoxin (EC 1.11.1.15)| Length = 216 Score = 33.9 bits (76), Expect = 0.17 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGK--KYVILFFYPLDFTFVCPTEITAFSDRHE 424 ++G K P+ + +KL D+ K K+ ILF +P DFT VC TE R E Sbjct: 3 VIGEKFPEVEVKTTHGV----IKLPDHFTKQGKWFILFSHPADFTPVCTTEFYGMQKRLE 58
>TDXH_METMP (Q6LY19) Probable peroxiredoxin (EC 1.11.1.15)| Length = 217 Score = 33.5 bits (75), Expect = 0.22 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +2 Query: 341 KYVILFFYPLDFTFVCPTEITAFSDRHE 424 K+ +LF +P DFT VC TE AF R++ Sbjct: 31 KWFVLFSHPGDFTPVCTTEFVAFQKRYD 58
>TDXH2_SULME (O33665) Probable peroxiredoxin 2 (EC 1.11.1.15)| Length = 214 Score = 32.3 bits (72), Expect = 0.49 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 326 DYIGK-KYVILFFYPLDFTFVCPTEITAFS 412 D GK K++ LF +P DFT VC TE FS Sbjct: 24 DIFGKGKWLFLFAHPADFTPVCTTEFVEFS 53
>TDXH1_SULME (Q55060) Probable peroxiredoxin 1 (EC 1.11.1.15)| Length = 215 Score = 32.3 bits (72), Expect = 0.49 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +2 Query: 341 KYVILFFYPLDFTFVCPTEITAFSDRHE 424 K++ LF +P DFT VC TE FS +E Sbjct: 30 KWLFLFAHPADFTPVCTTEFVGFSKVYE 57
>TDXH_PYRFU (Q8U218) Probable peroxiredoxin (EC 1.11.1.15)| Length = 216 Score = 32.0 bits (71), Expect = 0.64 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +2 Query: 251 LVGNKAPDFAAEAVFDQEFINVKLSDYIGK--KYVILFFYPLDFTFVCPTEITAFSDRHE 424 ++G K P+ + +KL D+ K K+ +LF +P DFT VC TE R E Sbjct: 3 VIGEKFPEVEVKTTHGV----IKLPDHFTKQGKWFMLFSHPADFTPVCTTEFYGLQIRLE 58
>REHY_TORRU (P52574) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| peroxidase) (Rehydrin) Length = 218 Score = 31.6 bits (70), Expect = 0.83 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +2 Query: 254 VGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEI 400 +G+ PD A++ ++K+ DY + I+F +P D+ VC TE+ Sbjct: 7 LGDLVPDIQADSTMG----HIKVRDYCKDGWTIIFSHPGDYPPVCTTEL 51
>TPX_STAAW (Q8NW51) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.8 bits (68), Expect = 1.4 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = +2 Query: 257 GNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 G+ APDF V D + V L+DY GKK +I +D T VC + F+ Sbjct: 21 GDFAPDFT---VLDNDLNQVTLADYAGKKKLISVVPSID-TGVCDQQTRKFN 68
>TPX_STAAS (Q6G8L4) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.8 bits (68), Expect = 1.4 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = +2 Query: 257 GNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 G+ APDF V D + V L+DY GKK +I +D T VC + F+ Sbjct: 21 GDFAPDFT---VLDNDLNQVTLADYAGKKKLISVVPSID-TGVCDQQTRKFN 68
>TPX_STAAR (Q6GFZ4) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.8 bits (68), Expect = 1.4 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = +2 Query: 257 GNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 G+ APDF V D + V L+DY GKK +I +D T VC + F+ Sbjct: 21 GDFAPDFT---VLDNDLNQVTLADYAGKKKLISVVPSID-TGVCDQQTRKFN 68
>TPX_STAAN (P99146) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.8 bits (68), Expect = 1.4 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = +2 Query: 257 GNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 G+ APDF V D + V L+DY GKK +I +D T VC + F+ Sbjct: 21 GDFAPDFT---VLDNDLNQVTLADYAGKKKLISVVPSID-TGVCDQQTRKFN 68
>TPX_STAAM (P66954) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.8 bits (68), Expect = 1.4 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = +2 Query: 257 GNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 G+ APDF V D + V L+DY GKK +I +D T VC + F+ Sbjct: 21 GDFAPDFT---VLDNDLNQVTLADYAGKKKLISVVPSID-TGVCDQQTRKFN 68
>TPX_STAAC (Q5HF61) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.8 bits (68), Expect = 1.4 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = +2 Query: 257 GNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFS 412 G+ APDF V D + V L+DY GKK +I +D T VC + F+ Sbjct: 21 GDFAPDFT---VLDNDLNQVTLADYAGKKKLISVVPSID-TGVCDQQTRKFN 68
>UVRC_MYCMS (Q6MTU8) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 584 Score = 28.5 bits (62), Expect = 7.1 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = -3 Query: 409 ESRNLSWADEGEVQRVEEKNH----ILLPNVIR*LDVDELLVEHS 287 E +NLS +Q++ +KN +L+PN I LD+D+ L+E S Sbjct: 278 EGQNLSELFNSYLQQIYQKNIYPDVLLIPNEIELLDLDQNLLEFS 322
>METK_SULSO (Q980S9) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 404 Score = 28.1 bits (61), Expect = 9.2 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +2 Query: 269 PDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEIT 403 PD+ A+AV ++ + KLS Y KKY ++ + LD T V + T Sbjct: 30 PDYIADAVAEEA--SRKLSLYYLKKYGVILHHNLDKTLVVGGQAT 72 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,822,148 Number of Sequences: 219361 Number of extensions: 567161 Number of successful extensions: 1583 Number of sequences better than 10.0: 115 Number of HSP's better than 10.0 without gapping: 1549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1563 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
