| Clone Name | baet06b05 |
|---|---|
| Clone Library Name | barley_pub |
>MOT1_SCHPO (O43065) Probable helicase mot1 (EC 3.6.1.-) (TBP-associated factor| mot1) (Modifier of transcription 1) Length = 1953 Score = 31.6 bits (70), Expect = 1.0 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +2 Query: 302 AVFTIGPRADDVECLLRYAKLISPHDKLSHHVNELVKGVIE 424 +++ I D++C A + +DKL +N ++KG++E Sbjct: 965 SIYKIAKERQDIQCSASIASAMVTYDKLPKKLNSIIKGIME 1005
>GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC cell-derived| growth factor) (PCDGF) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 589 Score = 31.2 bits (69), Expect = 1.3 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +2 Query: 239 PVNYTFEVQAMSAEK-LPFVLPAVF-TIGPRADDVEC 343 P YT V+A + EK + F+ P V T+GP+ +VEC Sbjct: 481 PAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVEC 517
>SCO2_HUMAN (O43819) SCO2 protein homolog, mitochondrial precursor| Length = 266 Score = 30.4 bits (67), Expect = 2.3 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 260 VQAMSAEK-LPFVLPAVFTIGPRADDVECLLRYAKLISP 373 V+ + AE LP V P T+ P DDVE + RY + P Sbjct: 148 VRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHP 186
>CNRA_RALME (P37972) Nickel and cobalt resistance protein cnrA| Length = 1075 Score = 28.9 bits (63), Expect = 6.7 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 356 AKLISPHDKLSHHVNELVKGVIEGETRVLAAS 451 ++ + H K+SHHV ++ + I GE R AAS Sbjct: 275 SRAVIAHGKMSHHVGQVARVKIGGELRSGAAS 306
>CR4AA_BACTI (P16480) Pesticidal crystal protein cry4Aa (Insecticidal| delta-endotoxin CryIVA(a)) (Crystaline entomocidal protoxin) (135 kDa crystal protein) Length = 1180 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 181 LHVVHAVPGDGQVLGRARDSVHETHGARQAKESRSQQALD 62 L V+ P DG+ L R + + + +AK S +QQA D Sbjct: 941 LEVIEEGPIDGEALSRVKHMEKKWNDQMEAKRSETQQAYD 980
>CR4BA_BACTI (P05519) Pesticidal crystal protein cry4Ba (Insecticidal| delta-endotoxin CryIVB(a)) (Crystaline entomocidal protoxin) (128 kDa crystal protein) Length = 1136 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 181 LHVVHAVPGDGQVLGRARDSVHETHGARQAKESRSQQALD 62 L V+ P DG+ L R + + + +AK S +QQA D Sbjct: 897 LEVIEEGPIDGEALSRVKHMEKKWNDQMEAKRSETQQAYD 936
>POLN_HEVME (Q03495) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1691 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 457 GHGGRQHAGLALDHALDQLVDVVGELVVRGDELGVAEQALDV 332 GH + G +D A +D+ G +V G L QALD+ Sbjct: 496 GHDNEAYEGSDVDTAEPATLDITGSYIVDGRSLQTVYQALDL 537 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,292,036 Number of Sequences: 219361 Number of extensions: 848139 Number of successful extensions: 2877 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2876 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)