| Clone Name | baet04f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYI_THIDA (Q3SHS3) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 29 | 4.6 |
|---|
>SYI_THIDA (Q3SHS3) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 929 Score = 29.3 bits (64), Expect = 4.6 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -2 Query: 193 GVPLDGVPLPHPEAGEQASTTVGEESTSMARTSSAET 83 G L+G+PL HP Q VGE T+ A T + T Sbjct: 296 GQMLEGLPLWHPFQDRQVPVIVGEHVTADAGTGAVHT 332 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,097,110 Number of Sequences: 219361 Number of extensions: 261787 Number of successful extensions: 1183 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1182 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)