| Clone Name | baet04c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YJGN_SALTY (Q08022) Inner membrane protein yjgN (ORF X) | 30 | 1.8 | 2 | GPI8_SCHPO (Q9USP5) GPI-anchor transamidase precursor (EC 3.-.-.... | 29 | 4.0 | 3 | GALT7_DROME (Q8MV48) N-acetylgalactosaminyltransferase 7 (EC 2.4... | 28 | 6.9 | 4 | PER_DRONE (P91686) Period circadian protein (Fragment) | 28 | 9.0 |
|---|
>YJGN_SALTY (Q08022) Inner membrane protein yjgN (ORF X)| Length = 395 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 71 RLISIAACRHFSLGLSYPWNRIELLSW 151 RL+ + +LGL+YPW +I L+SW Sbjct: 327 RLLVVFVISGVTLGLAYPWLKIWLVSW 353
>GPI8_SCHPO (Q9USP5) GPI-anchor transamidase precursor (EC 3.-.-.-) (GPI| transamidase) Length = 380 Score = 28.9 bits (63), Expect = 4.0 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 20 IPGCTLLSYPHHPFPVSRLISIAACRHFSLGLSY 121 +P L Y HP +SR+IS C FS+G Y Sbjct: 342 LPPTRELKYKKHP--ISRIISAVVCISFSIGFPY 373
>GALT7_DROME (Q8MV48) N-acetylgalactosaminyltransferase 7 (EC 2.4.1.-)| (Protein-UDP acetylgalactosaminyltransferase 7) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7) (pp-GaNTase 7) (dGalNAc-T2) Length = 591 Score = 28.1 bits (61), Expect = 6.9 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 91 GGNGDKAR-NREGMVGVGEKCAPGDGDG 11 GGN R N G +GVGE+C D G Sbjct: 499 GGNNQLVRLNAAGQLGVGERCVEADRQG 526
>PER_DRONE (P91686) Period circadian protein (Fragment)| Length = 385 Score = 27.7 bits (60), Expect = 9.0 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 121 IAQAQAEVAAGGNGDKARNREGMVGVGEKCAPGDG 17 +++ Q VA GG G A + G G G A G G Sbjct: 217 LSKCQTSVAGGGGGGGAGSASGTCGTGNNGAGGGG 251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,350,527 Number of Sequences: 219361 Number of extensions: 418847 Number of successful extensions: 1594 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1594 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)