| Clone Name | baet03g10 |
|---|---|
| Clone Library Name | barley_pub |
>CHE1_CHEAL (Q8LGR0) Pollen allergen Che a 1 precursor| Length = 168 Score = 32.0 bits (71), Expect = 0.37 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = +1 Query: 169 GLAKCADCTGKNI-KAEEAFKALQVAIKCRN-SAGEYESKAVGALDGTGAFSVPLAGDLH 342 G+ C C + + + + V ++CRN +AG KA D G +S+P+ GD Sbjct: 34 GMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFE 93 Query: 343 SADCVAQL 366 C +L Sbjct: 94 DDICEIEL 101
>PHR_ECOLI (P00914) Deoxyribodipyrimidine photo-lyase (EC 4.1.99.3) (DNA| photolyase) (Photoreactivating enzyme) Length = 472 Score = 30.0 bits (66), Expect = 1.4 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +1 Query: 214 EEAFKALQVAIKCRNSAGEYE-SKAVGALDGTGAFSVPLA-GDLHSADCVAQL 366 EE Q+ C+N AGEYE + A++GT S LA G L C+ +L Sbjct: 204 EEKAAIAQLRQFCQNGAGEYEQQRDFPAVEGTSRLSASLATGGLSPRQCLHRL 256
>FRLB_SHIFL (P0AC01) Fructoselysine 6-phosphate deglycase (EC 3.5.-.-)| Length = 340 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/54 (25%), Positives = 24/54 (44%) Frame = +1 Query: 208 KAEEAFKALQVAIKCRNSAGEYESKAVGALDGTGAFSVPLAGDLHSADCVAQLH 369 K EE KAL++ C + +A + FS+ + ADC+ ++H Sbjct: 104 KTEEVIKALELGRACGALTAAFTKRADSPITSAAEFSID-----YQADCIWEIH 152
>FRLB_ECOLI (P0AC00) Fructoselysine 6-phosphate deglycase (EC 3.5.-.-)| Length = 340 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/54 (25%), Positives = 24/54 (44%) Frame = +1 Query: 208 KAEEAFKALQVAIKCRNSAGEYESKAVGALDGTGAFSVPLAGDLHSADCVAQLH 369 K EE KAL++ C + +A + FS+ + ADC+ ++H Sbjct: 104 KTEEVIKALELGRACGALTAAFTKRADSPITSAAEFSID-----YQADCIWEIH 152
>FRLB_ECO57 (Q8X844) Fructoselysine 6-phosphate deglycase (EC 3.5.-.-)| Length = 340 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/54 (25%), Positives = 24/54 (44%) Frame = +1 Query: 208 KAEEAFKALQVAIKCRNSAGEYESKAVGALDGTGAFSVPLAGDLHSADCVAQLH 369 K EE KAL++ C + +A + FS+ + ADC+ ++H Sbjct: 104 KTEEVIKALELGRACGALTAAFTKRADSPITSAAEFSID-----YQADCIWEIH 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.132 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,864,581 Number of Sequences: 219361 Number of extensions: 569376 Number of successful extensions: 2167 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2167 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)