| Clone Name | baet03e04 |
|---|---|
| Clone Library Name | barley_pub |
>TNKS1_HUMAN (O95271) Tankyrase 1 (EC 2.4.2.30) (TANK1) (Tankyrase I) (TNKS-1)| (TRF1-interacting ankyrin-related ADP-ribose polymerase) Length = 1327 Score = 32.3 bits (72), Expect = 0.59 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 304 HHQHHFQQSNRSCSGRRLPPHAPPP 230 HH HH QQ + G PP PPP Sbjct: 9 HHHHHHQQQLQPAPGASAPPPPPPP 33
>WASL_BOVIN (Q95107) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 505 Score = 32.3 bits (72), Expect = 0.59 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +1 Query: 1 LSSSCPTRPPIPPKCRSKNISLAPPPP 81 L SS P+ PP PP S + S+APPPP Sbjct: 350 LPSSAPSGPPPPPPPLSVSGSVAPPPP 376
>RSMB_VIBVY (Q7MGK4) Ribosomal RNA small subunit methyltransferase B (EC| 2.1.1.-) (rRNA (cytosine-C(5)-)-methyltransferase) (16S rRNA m5C967 methyltransferase) Length = 426 Score = 30.8 bits (68), Expect = 1.7 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -1 Query: 438 LADAGEVGDQPGFQFMWRKTRNGASSLRWPLVQEQDAECVQRCC 307 LA +V PGF+ W ++ A+ L + +Q +D E + CC Sbjct: 208 LAAPCDVHSLPGFEQGWVSVQDAAAQLSFNYLQPKDGELILDCC 251
>RSMB_VIBVU (Q8DDE5) Ribosomal RNA small subunit methyltransferase B (EC| 2.1.1.-) (rRNA (cytosine-C(5)-)-methyltransferase) (16S rRNA m5C967 methyltransferase) Length = 426 Score = 30.8 bits (68), Expect = 1.7 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -1 Query: 438 LADAGEVGDQPGFQFMWRKTRNGASSLRWPLVQEQDAECVQRCC 307 LA +V PGF+ W ++ A+ L + +Q +D E + CC Sbjct: 208 LAAPCDVHSLPGFEQGWVSVQDAAAQLSFNYLQPKDGELILDCC 251
>YW91_CAEEL (Q22712) Hypothetical protein T24A11.1 in chromosome III| Length = 938 Score = 29.6 bits (65), Expect = 3.8 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 1 LSSSCPTRP-PIPPKCRSKNISLAPPPP 81 L+S PTRP PIP C+S + S++ P P Sbjct: 895 LASMSPTRPQPIPISCKSSSNSISSPRP 922
>NIFA_AZOBR (P30667) Nif-specific regulatory protein| Length = 625 Score = 29.3 bits (64), Expect = 5.0 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 13 CPTRPPIPPKCRSKNISLAPPP 78 CP+R P+PP+ + + APPP Sbjct: 547 CPSRAPLPPQAPPPSPAAAPPP 568
>WASL_RAT (O08816) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 501 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 1 LSSSCPTRPPIPPKCRSKNISLAPPPP 81 L SS P+ PP PP + PPPP Sbjct: 347 LPSSAPSGPPPPPPLSMAGSTAPPPPP 373
>AKP8L_HUMAN (Q9ULX6) A-kinase anchor protein 8-like (AKAP8-like protein)| (Neighbor of A-kinase anchoring protein 95) (Neighbor of AKAP95) (Homologous to AKAP95 protein) (HA95) (Helicase A-binding protein 95) (HAP95) Length = 646 Score = 28.5 bits (62), Expect = 8.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 16 PTRPPIPPKCRSKNISLAPPPP 81 P +PP+PP+ +S PPPP Sbjct: 586 PAQPPVPPEPAPGAVSPPPPPP 607
>LCE4A_HUMAN (Q5TA78) Late cornified envelope protein 4A (Late envelope| protein 8) (Small proline-rich-like epidermal differentiation complex protein 4A) Length = 99 Score = 28.5 bits (62), Expect = 8.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 13 CPTRPPIPPKCRSKNISLAPPP 78 CP P PPKC SK S PPP Sbjct: 16 CPI-PKYPPKCPSKCASSCPPP 36 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.136 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,094,390 Number of Sequences: 219361 Number of extensions: 620174 Number of successful extensions: 3243 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3177 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)