ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet02g04 |
|---|---|
| Clone Library Name | barley_pub |
>KNU_ARATH (Q9FFX4) Zinc-finger protein KNUCKLES| Length = 161 Score = 53.9 bits (128), Expect = 1e-07 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERS 396 RLFPC +C +KF SQALGGHQNAHK+ER+ Sbjct: 36 RLFPCQYCPRKFYTSQALGGHQNAHKRERA 65
>ZFP4_ARATH (Q39263) Zinc finger protein 4| Length = 260 Score = 51.2 bits (121), Expect = 9e-07 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERSI 399 R+F C +C +KF SQALGGHQNAHK+ER++ Sbjct: 83 RVFSCNYCQRKFYSSQALGGHQNAHKRERTL 113
>ZFP1_ARATH (Q42485) Zinc finger protein 1| Length = 228 Score = 51.2 bits (121), Expect = 9e-07 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERSI 399 R+F C +C +KF SQALGGHQNAHK+ER++ Sbjct: 66 RVFSCNYCQRKFYSSQALGGHQNAHKRERTL 96
>ZFP7_ARATH (Q39266) Zinc finger protein 7| Length = 209 Score = 50.8 bits (120), Expect = 1e-06 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERSI 399 R+F C +C +KF SQALGGHQNAHK+ER++ Sbjct: 57 RVFSCNYCRRKFYSSQALGGHQNAHKRERTM 87
>ZFP2_ARATH (Q39261) Zinc finger protein 2| Length = 150 Score = 49.7 bits (117), Expect = 3e-06 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERSI 399 R+F C +C +KF SQALGGHQNAHK ER++ Sbjct: 50 RVFSCNYCQRKFYSSQALGGHQNAHKLERTL 80
>ZFP3_ARATH (Q39262) Zinc finger protein 3| Length = 235 Score = 48.9 bits (115), Expect = 5e-06 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERSI 399 +LF C +C + F SQALGGHQNAHK+ER++ Sbjct: 59 KLFSCNYCQRTFYSSQALGGHQNAHKRERTL 89
>ZFP6_ARATH (Q39265) Zinc finger protein 6| Length = 197 Score = 47.4 bits (111), Expect = 1e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERSI 399 R + C +C ++F SQALGGHQNAHKKER + Sbjct: 39 RKYECQYCCREFANSQALGGHQNAHKKERQL 69
>ZFP5_ARATH (Q39264) Zinc finger protein 5| Length = 211 Score = 47.0 bits (110), Expect = 2e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +1 Query: 319 CLFCNKKFLKSQALGGHQNAHKKER 393 C +C K+F SQALGGHQNAHKKER Sbjct: 62 CQYCGKEFANSQALGGHQNAHKKER 86
>SUP_ARATH (Q38895) Transcriptional regulator SUPERMAN| Length = 204 Score = 40.8 bits (94), Expect = 0.001 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERS 396 R + C FC ++F +QALGGH N H+++R+ Sbjct: 45 RSYTCSFCKREFRSAQALGGHMNVHRRDRA 74
>RBE_ARATH (Q9LHS9) Probable transcriptional regulator RABBIT EARS| Length = 226 Score = 40.8 bits (94), Expect = 0.001 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERS 396 R + C FC ++F +QALGGH N H+++R+ Sbjct: 53 RSYSCSFCGREFKSAQALGGHMNVHRRDRA 82
>MSN4_YEAST (P33749) Zinc finger protein MSN4 (Multicopy suppressor of SNF1| protein 4) Length = 630 Score = 34.3 bits (77), Expect = 0.12 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKK 387 R F C+FC KKF +S L H HKK Sbjct: 600 RPFACMFCEKKFSRSDNLSQHLKTHKK 626
>ZBT20_HUMAN (Q9HC78) Zinc finger and BTB domain-containing protein 20 (Zinc| finger protein 288) (Dendritic-derived BTB/POZ zinc finger protein) Length = 741 Score = 32.7 bits (73), Expect = 0.35 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 304 VRLFPCLFCNKKFLKSQALGGHQNAHKKERS 396 VR + C CNK+F + +L H H+ E+S Sbjct: 631 VRAYQCSICNKRFTQKSSLNVHMRLHRGEKS 661
>ZFP1_WHEAT (Q42430) Zinc-finger protein 1 (WZF1)| Length = 261 Score = 32.3 bits (72), Expect = 0.45 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHK 384 F C C K F QALGGH+ +H+ Sbjct: 90 FKCSVCGKSFSSYQALGGHKTSHR 113 Score = 30.8 bits (68), Expect = 1.3 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAH 381 R+ C C K+F QALGGH+ H Sbjct: 158 RVHRCSICQKEFPTGQALGGHKRKH 182
>ZFP90_RAT (Q4V8A8) Zinc finger protein 90 (Zfp-90)| Length = 633 Score = 32.0 bits (71), Expect = 0.59 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 F C C K F S +LG H+NAH E+ Sbjct: 279 FECNVCGKAFRHSSSLGQHENAHTGEK 305
>ZFP90_MOUSE (Q61967) Zinc finger protein 90 (Zfp-90) (Zinc finger protein NK10)| Length = 636 Score = 32.0 bits (71), Expect = 0.59 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 F C C K F S +LG H+NAH E+ Sbjct: 278 FECNVCGKAFRHSSSLGQHENAHTGEK 304
>ZFP90_HUMAN (Q8TF47) Zinc finger protein 90 homolog (Zfp-90)| Length = 636 Score = 32.0 bits (71), Expect = 0.59 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 F C C K F S +LG H+NAH E+ Sbjct: 282 FECNVCGKAFRHSSSLGQHENAHTGEK 308
>ZAN_MOUSE (O88799) Zonadhesin precursor| Length = 5376 Score = 32.0 bits (71), Expect = 0.59 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +3 Query: 33 NHTYIPLQC-THARFASLLPSLLPLC 107 N T IPLQC H+R+ + LPS PLC Sbjct: 3172 NCTNIPLQCPAHSRYTNCLPSCPPLC 3197 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 33 NHTYIPLQC-THARFASLLPSLLPLC 107 N IPLQC H+ F S LPS P C Sbjct: 3885 NCAKIPLQCPAHSHFTSCLPSCPPSC 3910
>ZO19_XENLA (P18742) Oocyte zinc finger protein XLCOF19 (Fragment)| Length = 168 Score = 31.6 bits (70), Expect = 0.78 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 FPC C K+F + Q L HQ++H E+ Sbjct: 6 FPCSECGKRFARRQHLTDHQSSHTGEK 32
>ZG53_XENLA (P18728) Gastrula zinc finger protein XLCGF53.1 (Fragment)| Length = 516 Score = 31.6 bits (70), Expect = 0.78 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 FPC C K+F + Q L HQ++H E+ Sbjct: 354 FPCSECGKRFARRQHLTDHQSSHTGEK 380
>ZN499_HUMAN (Q96K62) Zinc finger protein 499| Length = 511 Score = 31.6 bits (70), Expect = 0.78 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 304 VRLFPCLFCNKKFLKSQALGGHQNAHKKERS 396 VR F C C K+F + +L H H+ ER+ Sbjct: 456 VRAFQCAVCAKRFTQKSSLNVHMRTHRPERA 486
>TF3A_XENLA (P03001) Transcription factor IIIA (Factor A) (TFIIIA)| (S-TFIIIA/O-TFIIIA) Length = 366 Score = 31.2 bits (69), Expect = 1.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 319 CLFCNKKFLKSQALGGHQNAHKKERSI 399 C CN+KF L HQ H+KER++ Sbjct: 216 CDVCNRKFRHKDYLRDHQKTHEKERTV 242
>STE12_EMENI (O74252) Transcription factor steA| Length = 692 Score = 31.2 bits (69), Expect = 1.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R +PC +CNK F +S L H+ H+ ++ Sbjct: 592 RPYPCPYCNKAFSRSDNLAQHRRIHEAQQ 620
>ZN132_HUMAN (P52740) Zinc finger protein 132| Length = 589 Score = 31.2 bits (69), Expect = 1.0 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKE 390 +LF C C K FLKS L H H +E Sbjct: 117 KLFECSNCGKAFLKSSTLPNHLRTHSEE 144 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERS 396 R + C+ C K F + L HQ H +ER+ Sbjct: 536 RPYECIQCGKAFSERSTLVRHQKVHTRERT 565
>ZFY1_MOUSE (P10925) Zinc finger Y-chromosomal protein 1| Length = 782 Score = 30.8 bits (68), Expect = 1.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 304 VRLFPCLFCNKKFLKSQALGGHQNAH 381 +R++PC+FC KKF + L H H Sbjct: 400 LRVYPCMFCGKKFKTKRFLKRHTKNH 425
>MSN2_YEAST (P33748) Zinc finger protein MSN2 (Multicopy suppressor of SNF1| protein 2) Length = 704 Score = 30.8 bits (68), Expect = 1.3 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERSI 399 R F C C+KKF +S L H HKK I Sbjct: 674 RPFACHICDKKFSRSDNLSQHIKTHKKHGDI 704
>ZN287_HUMAN (Q9HBT7) Zinc finger protein 287| Length = 754 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERS 396 + C C KKF K +L HQ+ H KE+S Sbjct: 361 YKCNVCGKKFRKYPSLLKHQSTHAKEKS 388
>PRD10_HUMAN (Q9NQV6) PR domain zinc finger protein 10 (PR domain-containing| protein 10) Length = 1061 Score = 30.8 bits (68), Expect = 1.3 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSI 399 +PC CN++F+ S+ L H N+H ++ + Sbjct: 269 WPCYECNRRFISSEQLQQHLNSHDEKLDV 297
>XFIN_XENLA (P08045) Zinc finger protein Xfin| Length = 1350 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R + C+ C KKF + AL HQ H ER Sbjct: 162 RPYQCVECQKKFTERSALVNHQRTHTGER 190 Score = 30.4 bits (67), Expect = 1.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 F C C+KKF + AL HQ H E+ Sbjct: 410 FKCSHCDKKFTERSALAKHQRTHTGEK 436 Score = 30.0 bits (66), Expect = 2.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERSI 399 R + C C + F++ AL HQ HK E + Sbjct: 1042 RPYKCGLCERSFVEKSALSRHQRVHKNESPV 1072 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 FPC C+K F + AL H H ER Sbjct: 587 FPCYTCDKSFTERSALIKHHRTHTGER 613 Score = 28.5 bits (62), Expect = 6.6 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 +PC C K F++ L HQ H E+ Sbjct: 1192 YPCSTCGKSFIQKSDLAKHQRIHTGEK 1218
>ZSCA5_HUMAN (Q9BUG6) Zinc finger and SCAN domain-containing protein 5 (Zinc| finger protein 495) Length = 496 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 RLF C C K+F++ +L HQ H ER Sbjct: 382 RLFQCNLCGKRFMQLISLQFHQRTHTGER 410
>PRD12_HUMAN (Q9H4Q4) PR domain zinc finger protein 12 (PR domain-containing| protein 12) Length = 367 Score = 30.4 bits (67), Expect = 1.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 F C FCN++F +S L H H ER Sbjct: 271 FVCRFCNRRFSQSSTLRNHVRLHTGER 297
>ZN282_HUMAN (Q9UDV7) Zinc finger protein 282 (HTLV-I U5RE-binding protein 1)| (HUB-1) Length = 671 Score = 30.4 bits (67), Expect = 1.7 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R F C C K F++ Q L HQ H ER Sbjct: 600 RPFQCALCGKSFIRKQNLLKHQRIHTGER 628
>SP7_MOUSE (Q8VI67) Transcription factor Sp7 (Zinc finger protein osterix)| (C22) Length = 428 Score = 30.4 bits (67), Expect = 1.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAH 381 F CL C+K+F +S L HQ H Sbjct: 351 FTCLLCSKRFTRSDHLSKHQRTH 373
>SP7_HUMAN (Q8TDD2) Transcription factor Sp7 (Zinc finger protein osterix)| Length = 431 Score = 30.4 bits (67), Expect = 1.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAH 381 F CL C+K+F +S L HQ H Sbjct: 354 FTCLLCSKRFTRSDHLSKHQRTH 376
>BOWEL_DROME (Q9VQU9) Protein bowel (Brother of odd with entrails limited)| Length = 744 Score = 30.4 bits (67), Expect = 1.7 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 F C FCN++F KS L H+ H ER Sbjct: 238 FICKFCNRQFTKSYNLLIHERTHTDER 264
>SOB_DROME (Q9VQS7) Protein sister of odd and bowel| Length = 578 Score = 30.4 bits (67), Expect = 1.7 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 F C FCN++F KS L H+ H ER Sbjct: 395 FICKFCNRQFTKSYNLLIHERTHTDER 421
>PACC_KLULA (Q6CQ07) pH-response transcription factor pacC/RIM101| Length = 517 Score = 30.4 bits (67), Expect = 1.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSI 399 F C CNKKF + Q L H H +E S+ Sbjct: 177 FACSTCNKKFKRPQDLKKHLKVHNEELSL 205
>ZN358_HUMAN (Q9NW07) Zinc finger protein 358| Length = 481 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R +PC C K F +S AL HQ H ER Sbjct: 202 RPYPCPQCGKAFGQSSALLQHQRTHTAER 230
>ZN256_HUMAN (Q9Y2P7) Zinc finger protein 256 (Bone marrow zinc finger 3)| (BMZF-3) Length = 474 Score = 30.0 bits (66), Expect = 2.3 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 RL+ C C K F +S L HQ H ER Sbjct: 420 RLYECSECGKSFSQSSNLTNHQRIHSGER 448
>ZN398_HUMAN (Q8TD17) Zinc finger protein 398 (Zinc finger DNA-binding protein| p52/p71) Length = 642 Score = 30.0 bits (66), Expect = 2.3 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R FPC C K+F L H+ AH ER Sbjct: 425 RPFPCPDCPKRFADQARLTSHRRAHASER 453 Score = 29.6 bits (65), Expect = 2.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R +PC C+K F++ + L H+ H ER Sbjct: 509 RPYPCTDCSKSFMRKEHLLNHRRLHTGER 537
>ZN253_HUMAN (O75346) Zinc finger protein 253 (Bone marrow zinc finger 1)| (BMZF-1) Length = 275 Score = 30.0 bits (66), Expect = 2.3 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 304 VRLFPCLFCNKKFLKSQALGGHQNAHKKER 393 + LF C+ C K F +S L H+ H E+ Sbjct: 169 INLFKCIICGKAFKRSSTLTTHKKIHTGEK 198
>ZFY2_MOUSE (P20662) Zinc finger Y-chromosomal protein 2| Length = 783 Score = 30.0 bits (66), Expect = 2.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 304 VRLFPCLFCNKKFLKSQALGGHQNAH 381 +R++PC+FC KKF + L H H Sbjct: 400 LRVYPCMFCGKKFKTKRFLKRHIKNH 425
>ZN485_HUMAN (Q8NCK3) Zinc finger protein 485| Length = 441 Score = 29.6 bits (65), Expect = 2.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 + C C K F KS L GHQ H E+ Sbjct: 354 YQCRDCGKAFTKSSTLTGHQRIHTGEK 380 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSI 399 + C C K F +S AL H+ H KER++ Sbjct: 410 YKCNECGKAFPRSSALKQHKKIHNKERAM 438
>ZNF7_HUMAN (P17097) Zinc finger protein 7 (Zinc finger protein KOX4) (Zinc| finger protein HF.16) Length = 686 Score = 29.6 bits (65), Expect = 2.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERS 396 R +PC C K F +S L HQ H E++ Sbjct: 360 RPYPCKECGKAFSQSSTLAQHQRMHTGEKA 389
>ZN549_HUMAN (Q6P9A3) Zinc finger protein 549| Length = 640 Score = 29.6 bits (65), Expect = 2.9 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGH-QNAHKKERS 396 + C C K FL Q L GH Q H +ERS Sbjct: 275 YVCNICGKSFLHKQTLVGHQQRIHTRERS 303
>ZN426_HUMAN (Q9BUY5) Zinc finger protein 426| Length = 554 Score = 29.6 bits (65), Expect = 2.9 Identities = 11/34 (32%), Positives = 13/34 (38%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIGWNPY 414 F C C K F+ L H H E+ W Y Sbjct: 224 FECSHCGKSFINESYLQAHMRTHNGEKLYEWRNY 257 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERS 396 F C+ C K F S L GH H +E++ Sbjct: 392 FVCVECGKAFAVSSNLSGHLRTHTEEKA 419
>ZN584_HUMAN (Q8IVC4) Zinc finger protein 584| Length = 421 Score = 29.6 bits (65), Expect = 2.9 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 +LF C C K FLK+ AL H H +ER Sbjct: 157 KLFKCSDCGKVFLKAFALLDHLITHSEER 185
>ZN286_HUMAN (Q9HBT8) Zinc finger protein 286| Length = 521 Score = 29.6 bits (65), Expect = 2.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 310 LFPCLFCNKKFLKSQALGGHQNAHKKER 393 LF C C K F +S +L HQ H ER Sbjct: 297 LFECSECKKTFTESSSLATHQRIHVGER 324
>ZN497_HUMAN (Q6ZNH5) Zinc finger protein 497| Length = 498 Score = 29.6 bits (65), Expect = 2.9 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 FPC C K F +S L HQ H ER Sbjct: 302 FPCAECGKAFRESSQLLQHQRTHTGER 328
>ZN449_HUMAN (Q6P9G9) Zinc finger protein 449 (Zinc finger and SCAN| domain-containing protein 19) Length = 518 Score = 29.6 bits (65), Expect = 2.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERS 396 R + C C K+F + L GHQ H +E + Sbjct: 377 RPYECTVCKKRFTRRSHLIGHQRTHSEEET 406
>ZN212_HUMAN (Q9UDV6) Zinc finger protein 212 (Zinc finger protein C2H2-150)| Length = 495 Score = 29.6 bits (65), Expect = 2.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R + C C K F++ Q L HQ H++ER Sbjct: 453 RPYSCTECEKSFVQKQHLLQHQKIHQRER 481
>ZN646_HUMAN (O15015) Zinc finger protein 646| Length = 1829 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 310 LFPCLFCNKKFLKSQALGGHQNAHKKE 390 LFPC C K F AL H H E Sbjct: 74 LFPCTTCGKDFSNPMALKSHMRTHAPE 100 Score = 28.9 bits (63), Expect = 5.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 310 LFPCLFCNKKFLKSQALGGHQNAHKKER 393 ++PC C+K+ + AL H AH + R Sbjct: 400 VYPCSLCSKQLFNAAALKNHVRAHHRPR 427
>SP6_HUMAN (Q3SY56) Transcription factor Sp6 (Krueppel-like factor 14)| Length = 376 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHK--KERSIG 402 FPC C++ F++S L H H+ KE + G Sbjct: 314 FPCAVCSRVFMRSDHLAKHMKTHEGAKEEAAG 345
>ZNF91_HUMAN (Q05481) Zinc finger protein 91 (Zinc finger protein HTF10) (HPF7)| Length = 1191 Score = 29.3 bits (64), Expect = 3.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 + C C K F+ S L GH+ H +E+ Sbjct: 1050 YKCEECGKAFISSSTLNGHKRIHTREK 1076
>ZN549_PONPY (Q5RBQ3) Zinc finger protein 549| Length = 640 Score = 29.3 bits (64), Expect = 3.8 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGH-QNAHKKERS 396 + C C K FL Q L GH Q H +ERS Sbjct: 275 YVCNVCGKSFLHKQTLVGHQQRIHTRERS 303 Score = 28.5 bits (62), Expect = 6.6 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R + C C K F+ Q+L HQ H ER Sbjct: 387 RAYQCSECGKSFIYKQSLLDHQRIHTGER 415 Score = 28.1 bits (61), Expect = 8.6 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERS 396 + C+ C K F++S HQ H ER+ Sbjct: 445 YACIICGKSFIRSSDYMRHQRIHTGERA 472
>ZN432_HUMAN (O94892) Zinc finger protein 432| Length = 652 Score = 29.3 bits (64), Expect = 3.8 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERS 396 + C C K F + L HQ HK+E+S Sbjct: 233 YGCTLCAKVFSRKSRLNEHQRIHKREKS 260
>ZAS1_SCHPO (Q9UTS5) Zinc finger protein zas1| Length = 897 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 304 VRLFPCLFCNKKFLKSQALGGH-QNAHKKERSI 399 V+ F C FCN+ F +S L H Q H +++++ Sbjct: 53 VKAFSCSFCNRAFARSDVLNRHVQQMHLQKQNL 85
>ODD_DROME (P23803) Protein odd-skipped| Length = 392 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 F C +CN++F KS L H+ H ER Sbjct: 220 FICKYCNRQFTKSYNLLIHERTHTDER 246
>ZN263_HUMAN (O14978) Zinc finger protein 263 (Zinc finger protein FPM315)| Length = 683 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 +LF CL C K F + L HQ H E+ Sbjct: 573 KLFECLTCGKSFRQGMHLTRHQRTHTGEK 601
>ZFP11_MOUSE (P10751) Zinc finger protein 11 (Zfp-11) (Krox-6.1A protein)| Length = 647 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 RL+ C C K + S L HQ H +ER Sbjct: 587 RLYKCTECGKAYCFSSQLNRHQRIHTRER 615 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R + C C K F +S+ L HQ HK+E+ Sbjct: 83 RPYKCKECGKAFKRSRNLAQHQVTHKREK 111
>ZO15_XENLA (P18741) Oocyte zinc finger protein XLCOF15 (Fragment)| Length = 140 Score = 29.3 bits (64), Expect = 3.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 304 VRLFPCLFCNKKFLKSQALGGHQNAHKKER 393 V+ F C C+KKFL +L HQ H E+ Sbjct: 31 VKSFTCTECDKKFLTRSSLLLHQKVHTGEK 60
>YAOH_SCHPO (Q10096) Hypothetical zinc finger protein C11D3.17 in chromosome I| Length = 585 Score = 28.9 bits (63), Expect = 5.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERSI 399 R+FPC C K+F + + L H+ H K I Sbjct: 29 RVFPCDQCAKRFTRHENLTRHKACHSKAEPI 59
>ZN443_HUMAN (Q9Y2A4) Zinc finger protein 443 (Kruppel-type zinc finger protein| ZK1) Length = 671 Score = 28.9 bits (63), Expect = 5.0 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIGWNPY 414 + C C K F +L H+ H K+ G NPY Sbjct: 616 YECKECGKAFASLSSLHRHKKTHWKKTHTGENPY 649
>ZN694_HUMAN (Q63HK3) Zinc finger protein 694| Length = 967 Score = 28.9 bits (63), Expect = 5.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 F CL C K F S G HQ H E+ Sbjct: 803 FKCLDCGKSFNDSSNFGAHQRIHTGEK 829
>ZG46_XENLA (P18722) Gastrula zinc finger protein XLCGF46.1 (Fragment)| Length = 280 Score = 28.9 bits (63), Expect = 5.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 304 VRLFPCLFCNKKFLKSQALGGHQNAHKKE 390 ++ F C C K+FL Q L HQ H +E Sbjct: 31 IKPFECTECGKQFLLKQLLKSHQLIHTEE 59
>KRUH_DROME (P08155) Krueppel homologous protein 1| Length = 845 Score = 28.9 bits (63), Expect = 5.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R F C FC+K F + L H+ H KER Sbjct: 297 RPFECEFCHKLFSVKENLQVHRRIHTKER 325
>ZO14_XENLA (P18740) Oocyte zinc finger protein XLCOF14 (Fragment)| Length = 139 Score = 28.9 bits (63), Expect = 5.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 FPC C K F Q L HQ H E+ Sbjct: 33 FPCTECGKSFAAKQNLKRHQKIHTGEK 59
>ZNF31_HUMAN (P17040) Zinc finger protein 31 (Zinc finger protein KOX29) (Zinc| finger and SCAN domain-containing protein 20) (Zinc finger protein 360) Length = 977 Score = 28.9 bits (63), Expect = 5.0 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 + C C K F KS L HQ H E+ Sbjct: 837 YECAECGKSFSKSSTLANHQRTHTGEK 863
>ZO61_XENLA (P18750) Oocyte zinc finger protein XLCOF6.1 (Fragment)| Length = 224 Score = 28.5 bits (62), Expect = 6.6 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R F C C K+F + L HQ H ER Sbjct: 88 RPFSCSECGKRFARRSVLEAHQKIHTGER 116
>ZFP39_MOUSE (Q02525) Zinc finger protein 39 (Zfp-39) (CtFIN33) (Fragment)| Length = 201 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIG 402 + C C K F + LG HQ H E+ G Sbjct: 114 YGCSLCGKAFYRKSHLGRHQKIHTGEKPYG 143
>TCF17_RAT (Q02975) Zinc finger protein 354A (Transcription factor 17) (Renal| transcription factor Kid-1) (Kidney, ischemia, and developmentally-regulated protein 1) Length = 576 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 +LF C C+K F +S AL HQ H E+ Sbjct: 214 KLFKCKECSKAFSQSSALIQHQITHTGEK 242
>TCF17_MOUSE (Q61751) Zinc finger protein 354A (Transcription factor 17) (Renal| transcription factor Kid-1) (Kidney, ischemia, and developmentally-regulated protein 1) Length = 572 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 +LF C C+K F +S AL HQ H E+ Sbjct: 210 KLFKCKECSKAFSQSSALIQHQITHTGEK 238
>PRDM2_HUMAN (Q13029) PR domain zinc finger protein 2 (PR domain-containing| protein 2) (Retinoblastoma protein-interacting zinc-finger protein) (Zinc finger protein RIZ) (MTE-binding protein) (MTB-ZF) (GATA-3-binding protein G3B) Length = 1718 Score = 28.5 bits (62), Expect = 6.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 310 LFPCLFCNKKFLKSQALGGHQNAH 381 +FPC C +KF Q L H + H Sbjct: 359 MFPCQHCERKFTTKQGLERHMHIH 382
>BTBD4_MOUSE (Q8BID6) BTB/POZ domain-containing protein 4| Length = 600 Score = 28.5 bits (62), Expect = 6.6 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R +PC C KKF + + + H H K++ Sbjct: 444 RPYPCEICGKKFTRREHMKRHTLVHSKDK 472
>ZKSC1_RAT (Q4KLI1) Zinc finger with KRAB and SCAN domain-containing protein 1| Length = 562 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIGWNP 411 + C C K F +S L H H +ER+ ++P Sbjct: 516 YKCTKCGKAFTRSSTLTLHHRIHARERASEYSP 548
>ZKSC1_PONPY (Q5R670) Zinc finger with KRAB and SCAN domain-containing protein 1| Length = 563 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIGWNP 411 + C C K F +S L H H +ER+ ++P Sbjct: 517 YKCTKCGKAFTRSSTLTLHHRIHARERASEYSP 549
>ZKSC1_HUMAN (P17029) Zinc finger with KRAB and SCAN domain-containing protein 1| (Zinc finger protein 36) (Zinc finger protein KOX18) Length = 563 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIGWNP 411 + C C K F +S L H H +ER+ ++P Sbjct: 517 YKCTKCGKAFTRSSTLTLHHRIHARERASEYSP 549
>PRDM2_RAT (Q63755) PR domain zinc finger protein 2 (PR domain-containing| protein 2) (Retinoblastoma protein-interacting zinc-finger protein) (Zinc finger protein RIZ) Length = 1706 Score = 28.5 bits (62), Expect = 6.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 310 LFPCLFCNKKFLKSQALGGHQNAH 381 +FPC C +KF Q L H + H Sbjct: 354 MFPCQHCERKFATKQGLERHMHIH 377
>BTBD4_HUMAN (Q86UZ6) BTB/POZ domain-containing protein 4 (Zinc finger protein| 340) Length = 589 Score = 28.5 bits (62), Expect = 6.6 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R +PC C KKF + + + H H K++ Sbjct: 444 RPYPCEICGKKFTRREHMKRHTLVHSKDK 472
>ZN677_HUMAN (Q86XU0) Zinc finger protein 677| Length = 584 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 + C C+K F+K L GHQ H E+ Sbjct: 459 YKCNKCDKAFIKRSHLWGHQRTHTGEK 485
>ZN350_HUMAN (Q9GZX5) Zinc finger protein 350 (Zinc-finger protein ZBRK1) (Zinc| finger and BRCA1-interacting protein with a KRAB domain 1) (KRAB zinc finger protein ZFQR) Length = 532 Score = 28.5 bits (62), Expect = 6.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIGWN 408 F C C K F Q L HQ H ER G N Sbjct: 374 FECSECGKAFSTKQKLIVHQRTHTGERPYGCN 405
>ZN337_HUMAN (Q9Y3M9) Zinc finger protein 337| Length = 751 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERS 396 +LF C C++ F AL HQN H E+S Sbjct: 206 KLFTCRECHQGFRDESALLLHQNTHTGEKS 235
>TCF17_HUMAN (O60765) Zinc finger protein 354A (Transcription factor 17) (Zinc| finger protein eZNF) Length = 605 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 +LF C C+K F +S AL HQ H E+ Sbjct: 240 KLFKCKECSKAFSQSSALIQHQITHTGEK 268
>ZN213_HUMAN (O14771) Zinc finger protein 213 (Putative transcription factor| CR53) Length = 459 Score = 28.5 bits (62), Expect = 6.6 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIG 402 F C C K F +S L HQ H E+ G Sbjct: 373 FSCSECGKSFSRSAYLADHQRIHTGEKPFG 402
>ZN197_HUMAN (O14709) Zinc finger protein 197 (ZnF20)| Length = 1029 Score = 28.5 bits (62), Expect = 6.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIGWN 408 + C C K F+ ++L GHQ H +E+S N Sbjct: 790 YECDECGKCFILKKSLIGHQRIHTREKSYKCN 821 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIGWN 408 + C C K F + L GHQ H E+ G N Sbjct: 930 YECDKCRKSFTSKRNLVGHQRIHTGEKPYGCN 961 Score = 28.1 bits (61), Expect = 8.6 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIG 402 + C C K F++S++L HQ H ++++ G Sbjct: 566 YKCKECGKVFIRSKSLLLHQRVHTEKKTFG 595
>ZN510_HUMAN (Q9Y2H8) Zinc finger protein 510| Length = 683 Score = 28.5 bits (62), Expect = 6.6 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIGWN 408 F C C KKF++ L HQ H E+ N Sbjct: 600 FKCNECGKKFVRKAILSDHQRIHTGEKPFQCN 631
>TOPI_DROME (Q9VH70) Testis-specific zinc finger protein topi (Protein| matotopetli) Length = 814 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R + C C K+F ++ AL HQ H E+ Sbjct: 596 RRYECEECGKRFYRADALKNHQRIHTGEK 624
>ZKSC1_MOUSE (Q8BGS3) Zinc finger with KRAB and SCAN domain-containing protein 1| Length = 561 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKERSIGWNP 411 + C C K F +S L H H +ER+ ++P Sbjct: 515 YKCTKCGKAFTRSSTLTLHHRIHARERTSEYSP 547
>ZG71_XENLA (P18736) Gastrula zinc finger protein XLCGF71.1 (Fragment)| Length = 140 Score = 28.5 bits (62), Expect = 6.6 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 F CL C K F K +L HQ H E+ Sbjct: 62 FSCLECEKCFSKQSSLVSHQRTHTGEK 88
>ZN274_HUMAN (Q96GC6) Zinc finger protein 274 (Zinc finger protein HFB101) (Zinc| finger protein zfp2) (Zf2) Length = 653 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R + C C K F++S +L HQ H ER Sbjct: 533 RPYVCQDCGKGFVQSSSLTQHQRVHSGER 561
>ZN155_HUMAN (Q12901) Zinc finger protein 155| Length = 538 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 +LF C C K+F +S L HQ H E+ Sbjct: 202 KLFMCDVCGKEFSQSSHLQTHQRVHTGEK 230
>SP6_MOUSE (Q9ESX2) Transcription factor Sp6 (Krueppel-like factor 14)| (Epiprofin) Length = 376 Score = 28.1 bits (61), Expect = 8.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHK 384 FPC C++ F++S L H H+ Sbjct: 314 FPCAVCSRVFMRSDHLAKHMKTHE 337
>ZO28_XENLA (P18747) Oocyte zinc finger protein XLCOF28 (Fragment)| Length = 439 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 ++F C C K F+K L H+ H +ER Sbjct: 32 KIFKCTECEKSFMKRSQLIVHKKCHIEER 60
>TREF1_MOUSE (Q8BXJ2) Transcriptional-regulating factor 1| (Transcriptional-regulating protein 132) (Zinc finger transcription factor TReP-132) Length = 1205 Score = 28.1 bits (61), Expect = 8.6 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 310 LFPCLFCNKKFLKSQALGGHQNAHKKE 390 +FPC C K F K ++ H H+++ Sbjct: 1091 IFPCKECGKVFFKIKSRNAHMKTHRQQ 1117
>ZN319_HUMAN (Q9P2F9) Zinc finger protein 319| Length = 582 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAH 381 R F C CNK + ++ AL HQ AH Sbjct: 426 RPFKCPVCNKAYKRASALQKHQLAH 450
>ZN12_MICSA (P38621) Zinc finger protein ZFMSA12A| Length = 415 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 304 VRLFPCLFCNKKFLKSQALGGHQNAHKKER 393 V+ F C C K F K LG H+ H + R Sbjct: 158 VQKFDCSQCGKSFKKMHLLGKHELTHTQNR 187
>FZF1_YEAST (P32805) Zinc finger protein FZF1 (Sulphite resistance protein 1)| Length = 299 Score = 28.1 bits (61), Expect = 8.6 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 319 CLFCNKKFLKSQALGGHQNAHKKERSI 399 C C K+F+ +Q L H N+H+++ + Sbjct: 74 CTLCQKRFVTNQQLRRHLNSHERKSKL 100
>ZNF96_MOUSE (Q9Z1D7) Zinc finger protein 96 (Zfp-96)| Length = 501 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAH 381 R + CL CNK F + L HQ H Sbjct: 379 RPYQCLQCNKSFNRRSTLSQHQGVH 403
>ZN623_HUMAN (O75123) Zinc finger protein 623| Length = 536 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 R F C C K F++S L HQ H ER Sbjct: 317 RPFECNECGKAFIRSSKLIQHQRIHTGER 345
>ZN445_MOUSE (Q8R2V3) Zinc finger protein 445| Length = 986 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 + FPC C K F + ++L HQ H E+ Sbjct: 632 KTFPCQNCGKTFTQKKSLIEHQRIHTGEK 660
>ZFP28_HUMAN (Q8NHY6) Zinc finger protein 28 homolog (Zfp-28) (Kruppel-like zinc| finger factor X6) Length = 868 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 +LF C C K F +S +L HQ H E+ Sbjct: 418 KLFKCNECKKTFTQSSSLTVHQRIHTGEK 446
>ZNF81_HUMAN (P51508) Zinc finger protein 81 (HFZ20)| Length = 661 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 +LF C C K F + AL HQ H ER Sbjct: 384 KLFECSECGKGFSLNSALNIHQKIHTGER 412
>ZG20_XENLA (P18714) Gastrula zinc finger protein XFG20-1 (XLCGF20.1)| Length = 675 Score = 28.1 bits (61), Expect = 8.6 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 +PC C+K F K + L H H E+ Sbjct: 507 YPCTECDKTFTKKEQLESHYKVHTGEK 533
>ZBT10_RAT (Q9WTY8) Zinc finger and BTB domain-containing protein 10 (Zinc| finger protein RIN ZF) Length = 836 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 304 VRLFPCLFCNKKFLKSQALGGHQNAHKKER 393 VR F C C K F + + + H HKK++ Sbjct: 714 VRSFKCEICGKMFTRREHVKRHSLVHKKDK 743
>ZNF84_HUMAN (P51523) Zinc finger protein 84 (Zinc finger protein HPF2)| Length = 738 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKERSIG 402 +L+ C C K+F K +L HQ+ H ++ + G Sbjct: 205 KLYECSECRKRFSKKPSLIKHQSRHIRDIAFG 236
>TREF1_HUMAN (Q96PN7) Transcriptional-regulating factor 1| (Transcriptional-regulating protein 132) (Zinc finger transcription factor TReP-132) (Zinc finger protein rapa) Length = 1200 Score = 28.1 bits (61), Expect = 8.6 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 310 LFPCLFCNKKFLKSQALGGHQNAHKKE 390 +FPC C K F K ++ H H+++ Sbjct: 1085 IFPCKECGKVFFKIKSRNAHMKTHRQQ 1111
>ZFP28_MOUSE (P10078) Zinc finger protein 28 (Zfp-28) (mKR5 protein)| Length = 825 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 307 RLFPCLFCNKKFLKSQALGGHQNAHKKER 393 +LF C C K F +S +L HQ H E+ Sbjct: 375 KLFQCNECKKTFTQSSSLTVHQRIHTGEK 403
>ZN500_HUMAN (O60304) Zinc finger protein 500| Length = 480 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 +PC C K+F +S +L H+ H ER Sbjct: 381 YPCPECGKRFSQSSSLVIHRRTHSGER 407
>ZG16_XENLA (P18712) Gastrula zinc finger protein XLCGF16.1 (Fragment)| Length = 112 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 313 FPCLFCNKKFLKSQALGGHQNAHKKER 393 F C C ++F+ AL GHQ H E+ Sbjct: 34 FVCFVCEQRFVCHSALIGHQRIHTGEK 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,650,949 Number of Sequences: 219361 Number of extensions: 451899 Number of successful extensions: 4694 Number of sequences better than 10.0: 108 Number of HSP's better than 10.0 without gapping: 2391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4694 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
