| Clone Name | baet02f04 |
|---|---|
| Clone Library Name | barley_pub |
>SUMF1_MOUSE (Q8R0F3) Sulfatase-modifying factor 1 precursor| (C-alpha-formyglycine-generating enzyme 1) Length = 372 Score = 32.0 bits (71), Expect = 0.76 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 5/82 (6%) Frame = +1 Query: 205 IKAEEAFKALQVAIKCRNSAGEYESKAVGALDGTGAFSVPLAADLHGADCVAQLHSAASN 384 I+ F L +A + S + +L G+ P A HG+ AQ +S +N Sbjct: 14 IRLARVFLLLVLACEVAGSDEAEAREGAASLAGSCGCGTPQRAGAHGSSAAAQRYSREAN 73 Query: 385 AP--CPGQEP---SKIVPVSEG 435 AP G P +K+VP+ G Sbjct: 74 APGLTSGPRPLALTKMVPIPAG 95
>SUMF1_HUMAN (Q8NBK3) Sulfatase-modifying factor 1 precursor| (C-alpha-formyglycine-generating enzyme 1) Length = 374 Score = 30.4 bits (67), Expect = 2.2 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 8/76 (10%) Frame = +1 Query: 232 LQVAIKCRNSAGEYES---KAVGALDGTGAFSVPLAADLHGADCVAQLHSAASNA--PCP 396 L +++ C +AG E+ G+L G+ P HG+ A +S +NA P P Sbjct: 23 LLLSLLC-GAAGSQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVP 81 Query: 397 GQEP---SKIVPVSEG 435 G+ SK+VP+ G Sbjct: 82 GERQLAHSKMVPIPAG 97
>SEC14_YARLI (P45816) SEC14 cytosolic factor| (Phosphatidylinositol/phosphatidylcholine transfer protein) (PI/PC TP) Length = 492 Score = 30.4 bits (67), Expect = 2.2 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = -3 Query: 407 GSWPGHGALEAALWSCATQSAPWRSAARGTLKAPVPSRAPTA 282 G+ GA AA S + Q+AP ++A KAPVP+ A TA Sbjct: 346 GTAAAGGAAAAAGASSSKQAAPAQAAPAQAAKAPVPAAAKTA 387
>ACBD4_PONPY (Q5R7P6) Acyl-CoA-binding domain-containing protein 4| Length = 269 Score = 29.3 bits (64), Expect = 4.9 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = -3 Query: 380 EAALWSCATQSAPWRSAARGTLKAPVPSRAPTALLSYS 267 EAA + + APW AR L PV R P AL + S Sbjct: 217 EAAAQAQCSAMAPWAPRARAALLPPVALRRPVALPNVS 254
>HEM3_LEIXX (Q6AHF1) Porphobilinogen deaminase (EC 2.5.1.61) (PBG)| (Hydroxymethylbilane synthase) (HMBS) (Pre-uroporphyrinogen synthase) Length = 329 Score = 28.9 bits (63), Expect = 6.4 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 265 GEYESKAVGALDGTGAFSVPLAADLHGADCVAQLHSAAS--NAPCPG 399 G+ +++ L GTG F+ L L +C +HS AP PG Sbjct: 53 GDTSRESLSELGGTGVFATALRDALRNGECDLVVHSLKDLPTAPAPG 99
>ANF_CAVPO (P27596) Atrial natriuretic factor precursor (ANF) (Atrial| natriuretic peptide) (ANP) (Prepronatriodilatin) [Contains: Cardiodilatin-related peptide (CDP)] (Fragment) Length = 128 Score = 28.9 bits (63), Expect = 6.4 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 8/41 (19%) Frame = -3 Query: 404 SWPGH--------GALEAALWSCATQSAPWRSAARGTLKAP 306 SWPG GAL W + +SAP +S R L AP Sbjct: 57 SWPGEAGPAQREGGALGRGPWDSSDRSAPLKSKLRALLDAP 97
>TRPE_AZOBR (P50872) Anthranilate synthase (EC 4.1.3.27) [Includes: Glutamine| amidotransferase] Length = 732 Score = 28.9 bits (63), Expect = 6.4 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 9/52 (17%) Frame = +1 Query: 286 VGALDGTGAFSVPLAAD-LHGADCVAQLH--------SAASNAPCPGQEPSK 414 + AL+G G +P A+ L G + +A L S+AS AP PG+E S+ Sbjct: 87 IDALNGRGQVLLPAVAEALRGLEALAGLEEAPSRVTASSASPAPLPGEERSR 138
>SYS_MANSM (Q65SK3) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 430 Score = 28.5 bits (62), Expect = 8.4 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +1 Query: 214 EEAFKALQVAIKCRNSAGEYESKAVGALDGTGAFSVPLAADL 339 EE KALQV + + SKAVGA G PL A++ Sbjct: 35 EEQRKALQVETETLQAKRNARSKAVGAAKARGENIAPLLAEM 76
>AGLU_ASPNG (P56526) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 985 Score = 28.5 bits (62), Expect = 8.4 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +1 Query: 313 FSVPLAADLHGADCVAQL---HSAASNAPCPGQEPSKIVPVSEGTT 441 F++P +AD+ GA +A + +A + + CPG + SK+ S G T Sbjct: 35 FTIPASADV-GAQLIANIDDPQAADAQSVCPGYKASKVQHNSRGFT 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.132 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,826,358 Number of Sequences: 219361 Number of extensions: 737334 Number of successful extensions: 3045 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3044 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)