| Clone Name | baet02e07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DPOL_ADEB3 (O72540) DNA polymerase (EC 2.7.7.7) | 28 | 8.4 | 2 | DPYL1_RAT (Q62950) Dihydropyrimidinase-related protein 1 (DRP-1)... | 28 | 8.4 | 3 | DPYL1_MOUSE (P97427) Dihydropyrimidinase-related protein 1 (DRP-... | 28 | 8.4 | 4 | DPYL1_HUMAN (Q14194) Dihydropyrimidinase-related protein 1 (DRP-... | 28 | 8.4 |
|---|
>DPOL_ADEB3 (O72540) DNA polymerase (EC 2.7.7.7)| Length = 1023 Score = 28.5 bits (62), Expect = 8.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 444 HPFPAGAPLRPADLSL 397 HPFPAG PL P D +L Sbjct: 516 HPFPAGKPLNPFDRAL 531
>DPYL1_RAT (Q62950) Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin| response mediator protein 1) (CRMP-1) Length = 572 Score = 28.5 bits (62), Expect = 8.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 212 MRGAVYYVQSPSRDSHDGETTTKGATSVHSTPALSPMASP 331 +R V+ + S SR +DG AT H+ PA S +SP Sbjct: 484 IRSKVFGLHSVSRGMYDGPVYEVPATPKHAAPAPSAKSSP 523
>DPYL1_MOUSE (P97427) Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin| response mediator protein 1) (CRMP-1) (ULIP3 protein) Length = 572 Score = 28.5 bits (62), Expect = 8.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 212 MRGAVYYVQSPSRDSHDGETTTKGATSVHSTPALSPMASP 331 +R V+ + S SR +DG AT H+ PA S +SP Sbjct: 484 IRSKVFGLHSVSRGMYDGPVYEVPATPKHAAPAPSAKSSP 523
>DPYL1_HUMAN (Q14194) Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin| response mediator protein 1) (CRMP-1) Length = 572 Score = 28.5 bits (62), Expect = 8.4 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +2 Query: 212 MRGAVYYVQSPSRDSHDGETTTKGATSVHSTPALSPMASP 331 +R V+ +Q SR +DG AT ++TPA S +SP Sbjct: 484 IRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSP 523 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,753,020 Number of Sequences: 219361 Number of extensions: 318838 Number of successful extensions: 1172 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1172 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)