| Clone Name | baet02a04 |
|---|---|
| Clone Library Name | barley_pub |
>EXTN3_ARATH (Q9FS16) Extensin-3 precursor (AtExt3) (AtExt5)| Length = 427 Score = 33.9 bits (76), Expect = 0.23 Identities = 25/91 (27%), Positives = 34/91 (37%) Frame = -1 Query: 356 YSPRNPKTLISHKVPAESYKQHPPIPGRHRLWLRLGRYLIVFEPPTFVLD**KHPWQMLS 177 +SP PK +K P K + P P H Y+ PP P + S Sbjct: 331 HSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP---------PVKHYS 381 Query: 176 QLFVFHKSKNFTSDYEIRMPPTVPINHYSDP 84 V+H Y + PP P++HYS P Sbjct: 382 PPPVYHSPPPPKEKYVYKSPPPPPVHHYSPP 412
>ORK1_DROME (Q94526) Open rectifier potassium channel protein 1 (Two pore| domain potassium channel Ork1) Length = 1001 Score = 32.3 bits (72), Expect = 0.66 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 302 RTPPAPYEKSKSLGSGGSMVARLKLKGIDGRAPP 403 R PP P+E + SL SGG + + + DG PP Sbjct: 599 RGPPPPFESNGSLASGGGGLTNMGFQMEDGATPP 632
>APE1_AERPE (O73942) Homing endonuclease I-ApeI (EC 3.1.-.-) (rRNA| intron-encoded homing endonuclease 1) Length = 222 Score = 32.0 bits (71), Expect = 0.87 Identities = 19/34 (55%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +2 Query: 326 KSKSLGS--GGSMVARLKLKGIDGRAPPGVEPAA 421 KSK L G + KLKGI G AP GVEPAA Sbjct: 189 KSKKLNELLGRPLPGPSKLKGIGGGAPQGVEPAA 222
>AKT6_ARATH (Q8GXE6) Potassium channel AKT6 (Shaker pollen inward rectifier| K(+) channel) (Potassium channel SPIK) Length = 888 Score = 30.0 bits (66), Expect = 3.3 Identities = 20/55 (36%), Positives = 27/55 (49%) Frame = +2 Query: 197 VFINQERKLGARRRSDTVLVSTINDADQGSADVAYRTPPAPYEKSKSLGSGGSMV 361 V ++Q+RKL R S ++S N AD G R+P P G GGSM+ Sbjct: 773 VVVSQKRKLNNFRNSLFGIISAANSADDGGE--VPRSPAVP-------GGGGSMI 818
>TRI32_MOUSE (Q8CH72) Tripartite motif protein 32 (EC 6.3.2.-)| Length = 655 Score = 29.6 bits (65), Expect = 4.3 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = -2 Query: 445 GVLLCL*LSRRLHAWWCPSVNSFKFQPC---DHTPPG 344 G+L+C RRL +C S +PC DH PPG Sbjct: 97 GLLMCRGCGRRLPRQFCRSCGVVLCEPCREADHQPPG 133
>TRI32_HUMAN (Q13049) Tripartite motif protein 32 (EC 6.3.2.-) (Zinc-finger| protein HT2A) (72 kDa Tat-interacting protein) Length = 653 Score = 29.6 bits (65), Expect = 4.3 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = -2 Query: 445 GVLLCL*LSRRLHAWWCPSVNSFKFQPC---DHTPPG 344 G+L+C RRL +C S +PC DH PPG Sbjct: 96 GLLMCRSCGRRLPRQFCRSCGLVLCEPCREADHQPPG 132
>NEU1_CATCO (P15210) Isoticin-neurophysin IT 1 precursor [Contains: Isotocin| (IT); Neurophysin IT 1] Length = 154 Score = 29.3 bits (64), Expect = 5.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 181 SICQGCFH*SRTKVGGSKTIRYRPSLNHKRCRPGIGGCC 297 S+C C+ S +GG + I+ PS C PG G C Sbjct: 16 SVCSACYI-SNCPIGGKRAIQDSPSRQCMSCGPGDRGRC 53
>RGYR_SULSH (P74759) Reverse gyrase [Includes: Helicase (EC 3.6.1.-);| Topoisomerase (EC 5.99.1.3)] Length = 1166 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +3 Query: 126 YFIVRGEILGFMKDEQLRKHLPRMFSLIKNE 218 + I++GE + + K EQLR+ L SL+K++ Sbjct: 439 FSIIKGETINYQKLEQLRQELLYYISLVKDK 469
>NEU2_CATCO (P15211) Isoticin-neurophysin IT 2 precursor [Contains: Isotocin| (IT); Neurophysin IT 2] Length = 148 Score = 28.5 bits (62), Expect = 9.6 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 181 SICQGCFH*SRTKVGGSKTIRYRPSLNHKRCRPGIGGCC 297 S+C C+ S +GG + ++ PS C PG G C Sbjct: 16 SVCSACYI-SNCPIGGKRAVQDLPSRQCMSCGPGDRGRC 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,122,807 Number of Sequences: 219361 Number of extensions: 1681421 Number of successful extensions: 3750 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3747 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)