| Clone Name | baet01g11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | 14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor | 55 | 1e-07 | 2 | CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor ... | 53 | 4e-07 | 3 | PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein | 49 | 5e-06 | 4 | HPSE_SOYBN (P24337) Hydrophobic seed protein (HPS) (Allergen Gly... | 42 | 5e-04 | 5 | XYNB_PSEFL (P23030) Endo-1,4-beta-xylanase B precursor (EC 3.2.1... | 28 | 7.6 | 6 | GIGAN_ORYSA (Q9AWL7) GIGANTEA protein | 28 | 9.9 |
|---|
>14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor| Length = 137 Score = 54.7 bits (130), Expect = 1e-07 Identities = 29/56 (51%), Positives = 33/56 (58%) Frame = +1 Query: 253 DTLKLGACANXXXXXXXXXXXXXXXXXDKCCSLLGGLADLEAAVCLCTALKANVLG 420 D LKLG CA+ CCSLL GL +LEAAVCLCTA+KAN+LG Sbjct: 57 DALKLGVCADVLNLVHNVVIGSPPTL--PCCSLLEGLVNLEAAVCLCTAIKANILG 110
>CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor (Root-specific| protein ZRP3) Length = 129 Score = 52.8 bits (125), Expect = 4e-07 Identities = 29/59 (49%), Positives = 34/59 (57%) Frame = +1 Query: 253 DTLKLGACANXXXXXXXXXXXXXXXXXDKCCSLLGGLADLEAAVCLCTALKANVLGIVL 429 D LKL CA ++CC LL GL DL+AA+CLCTA+KANVLGI L Sbjct: 51 DALKLKVCAKVLGLVKVGLPQY-----EQCCPLLEGLVDLDAALCLCTAIKANVLGIHL 104
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 48.9 bits (115), Expect = 5e-06 Identities = 24/57 (42%), Positives = 30/57 (52%) Frame = +1 Query: 253 DTLKLGACANXXXXXXXXXXXXXXXXXDKCCSLLGGLADLEAAVCLCTALKANVLGI 423 D LKLGAC + CC LLGGL DL+AA+CLCT ++ +L I Sbjct: 264 DALKLGACVDVLGGLIHIGIGGSAKQT--CCPLLGGLVDLDAAICLCTTIRLKLLNI 318
>HPSE_SOYBN (P24337) Hydrophobic seed protein (HPS) (Allergen Gly m 1)| Length = 80 Score = 42.4 bits (98), Expect = 5e-04 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +1 Query: 334 DKCCSLLGGLADLEAAVCLCTALKANVLGIV 426 D CC+L+GGL D+EA VCLC L+A LGI+ Sbjct: 26 DDCCALIGGLGDIEAIVCLCIQLRA--LGIL 54
>XYNB_PSEFL (P23030) Endo-1,4-beta-xylanase B precursor (EC 3.2.1.8) (Xylanase| B) (1,4-beta-D-xylan xylanohydrolase B) Length = 592 Score = 28.5 bits (62), Expect = 7.6 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 28 TTSASQLKQPGAMASRTFSAACLLALLVANTFLAGDAC 141 T SAS + PG RT + C+ L A F A AC Sbjct: 2 TISASDYRHPGNFLKRTTALLCVGTALTALAFNASAAC 39
>GIGAN_ORYSA (Q9AWL7) GIGANTEA protein| Length = 1160 Score = 28.1 bits (61), Expect = 9.9 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -1 Query: 152 WQLLQASPARNVLATSSASRQAAEKVLDAI 63 WQ L ASP + A S+++ Q KV+DA+ Sbjct: 908 WQKLIASPEMQMSAESTSAHQGWRKVVDAL 937 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,702,084 Number of Sequences: 219361 Number of extensions: 288942 Number of successful extensions: 1078 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1078 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)