| Clone Name | baet01e08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | STP2_YEAST (P38704) Zinc finger protein STP2 | 28 | 6.2 | 2 | SPA9_HUMAN (Q86WD7) Serpin A9 precursor (Germinal center B-cell ... | 28 | 6.2 | 3 | SYNJ1_RAT (Q62910) Synaptojanin-1 (EC 3.1.3.36) (Synaptic inosit... | 28 | 6.2 | 4 | ZN282_HUMAN (Q9UDV7) Zinc finger protein 282 (HTLV-I U5RE-bindin... | 28 | 8.1 |
|---|
>STP2_YEAST (P38704) Zinc finger protein STP2| Length = 541 Score = 28.1 bits (61), Expect = 6.2 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +1 Query: 61 SVCLTLSLVAAITREPSRPEPSRKISEPFVSYSPQPQHFPNEGLYKA 201 +V L+L I R PSR EP+ K+ +S P + + N YKA Sbjct: 113 AVTTQLNLDEPILRGPSRGEPA-KLQNDLISSPPLEESYINNDQYKA 158
>SPA9_HUMAN (Q86WD7) Serpin A9 precursor (Germinal center B-cell expressed| transcript 1 protein) Length = 417 Score = 28.1 bits (61), Expect = 6.2 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 28 MAKYLYGS-FAISVCLTLSLVAAITREPSRPEPSRKISEP 144 MA YLYG FA+ +C + V+ + P PS S P Sbjct: 1 MASYLYGVLFAVGLCAPIYCVSPANAPSAYPRPSSTKSTP 40
>SYNJ1_RAT (Q62910) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1574 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 88 AAITREPSRPEPSRKISEPFVSY-SPQPQHFPNEGL 192 AA +PS P P++K+ +P V +P P P L Sbjct: 1242 AAFPPQPSLPTPAQKLQDPLVPIAAPMPPSIPQSNL 1277
>ZN282_HUMAN (Q9UDV7) Zinc finger protein 282 (HTLV-I U5RE-binding protein 1)| (HUB-1) Length = 671 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 106 PSRPEPSRKISEPFVSYSPQPQHFP 180 P +P+P R+ +P + PQPQ P Sbjct: 407 PPQPQPQRQPPQPQLQSQPQPQSLP 431 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,842,626 Number of Sequences: 219361 Number of extensions: 650589 Number of successful extensions: 2187 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2185 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)