Clone Name | baak0b06 |
---|---|
Clone Library Name | barley_pub |
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 82.8 bits (203), Expect = 2e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXESGKA 130 KKEYPDAYVR+IGFDNLRQVQCVSFIAFRPPGC ESGKA Sbjct: 136 KKEYPDAYVRVIGFDNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 82.0 bits (201), Expect = 3e-16 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXESGKA 130 KKEYPDAYVR+IGFDN+RQVQCVSFIAFRPPGC ESGKA Sbjct: 137 KKEYPDAYVRVIGFDNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 81.3 bits (199), Expect = 5e-16 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXESGKA 130 KKEYPDAYVRIIGFDN+RQVQCVSFIAF+PPGC ESGKA Sbjct: 75 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 81.3 bits (199), Expect = 5e-16 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXESGKA 130 KKEYPDAYVRIIGFDN+RQVQCVSFIAF+PPGC ESGKA Sbjct: 136 KKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 69.3 bits (168), Expect = 2e-12 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXESGKA 130 +KEYPD Y RIIGFDN+RQVQ VSFIA +PPGC ESGKA Sbjct: 137 RKEYPDPYCRIIGFDNMRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 68.2 bits (165), Expect = 5e-12 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXESG 124 KK YPDA+VRIIGFDN+RQVQ +SFIA++PPGC ESG Sbjct: 137 KKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 67.8 bits (164), Expect = 6e-12 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXESG 124 KK YPDA++RIIGFDN+RQVQ +SFIA++PPGC ESG Sbjct: 137 KKAYPDAFIRIIGFDNVRQVQLISFIAYKPPGCEESG 173
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 60.8 bits (146), Expect = 8e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A++RIIGFDN RQVQCVSFIAF+PPG Sbjct: 148 KKAYPSAFIRIIGFDNKRQVQCVSFIAFKPPG 179
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 60.8 bits (146), Expect = 8e-10 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 KKEYP A++RIIGFDN RQVQC+SFIA++PP E+ Sbjct: 146 KKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 60.8 bits (146), Expect = 8e-10 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 KKEYP A++RIIGFDN RQVQC+SFIA++PP E+ Sbjct: 146 KKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTEA 181
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 60.5 bits (145), Expect = 1e-09 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP+A++RIIGFDN+RQVQC+SFIA++PPG Sbjct: 148 KKAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 60.5 bits (145), Expect = 1e-09 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP+A++RIIGFDN+RQVQC+SFIA++PPG Sbjct: 148 KKAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 60.1 bits (144), Expect = 1e-09 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPP 106 KKEYP+A++RIIGFDN RQVQC+SFIA++PP Sbjct: 146 KKEYPNAFIRIIGFDNTRQVQCISFIAYKPP 176
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 60.1 bits (144), Expect = 1e-09 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KKEYP+A++RIIGFDN+RQVQC+SFIA++P G Sbjct: 150 KKEYPNAFIRIIGFDNVRQVQCISFIAYKPKG 181
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 60.1 bits (144), Expect = 1e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXESG 124 KK YPDA+VRIIGFDN+RQVQ +SFIA+ PGC ESG Sbjct: 135 KKAYPDAFVRIIGFDNVRQVQLISFIAYN-PGCEESG 170
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 59.7 bits (143), Expect = 2e-09 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 KKEYP+A++RIIGFDN RQVQC+SFIA++PP ++ Sbjct: 47 KKEYPNAFIRIIGFDNNRQVQCISFIAYKPPSFTDA 82
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 59.7 bits (143), Expect = 2e-09 Identities = 23/30 (76%), Positives = 30/30 (100%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KKEYPDA++R+IGFDN+RQVQC+SFIA++P Sbjct: 150 KKEYPDAFIRVIGFDNVRQVQCISFIAYKP 179
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 59.7 bits (143), Expect = 2e-09 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KKEYP+A++R+IGFDN+RQVQC+SFI +PPG Sbjct: 148 KKEYPNAFIRVIGFDNIRQVQCISFIVAKPPG 179
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 59.7 bits (143), Expect = 2e-09 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 KKEYP A++RIIGFDN RQVQC+SFIA++PP ++ Sbjct: 146 KKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTDA 181
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 58.2 bits (139), Expect = 5e-09 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 KKEYP+A +RIIGFDN RQVQC+SFIA++PP ++ Sbjct: 146 KKEYPNALIRIIGFDNNRQVQCISFIAYKPPSFTDA 181
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 57.8 bits (138), Expect = 6e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KKEYP A++RIIGFDN RQVQC+SFIA++P G Sbjct: 148 KKEYPHAFIRIIGFDNNRQVQCISFIAYKPTG 179
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 57.8 bits (138), Expect = 6e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KKEYP A++RIIGFDN+RQVQCVSFIA +P G Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCVSFIASKPTG 172
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KKEYP A++RIIGFDN+RQVQC+SFIA +P G Sbjct: 146 KKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 177
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KKEYP A++RIIGFDN+RQVQC+SFIA +P G Sbjct: 146 KKEYPQAWIRIIGFDNVRQVQCISFIASKPEG 177
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 57.4 bits (137), Expect = 8e-09 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YPDA++RIIGFDN+RQVQC+SFIA++P Sbjct: 148 KKAYPDAHIRIIGFDNVRQVQCISFIAYKP 177
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A+VRIIGFDN+RQVQC+SFIA++P G Sbjct: 148 KKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A+VRIIGFDN+RQVQC+SFIA++P G Sbjct: 148 KKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A+VRIIGFDN+RQVQC+SFIA++P G Sbjct: 148 KKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A+VRIIGFDN+RQVQC+SFIA++P G Sbjct: 148 KKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 57.4 bits (137), Expect = 8e-09 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 K +PD Y RIIGFDN+RQVQC+SF+A++PPG Sbjct: 151 KHHPDGYARIIGFDNVRQVQCISFLAYKPPG 181
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KKEYP A++RIIGFDN+RQVQC+SFIA +P G Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KKEYP A++RIIGFDN+RQVQC+SFIA +P G Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KKEYP A++RIIGFDN+RQVQC+SFIA +P G Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 57.4 bits (137), Expect = 8e-09 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A++RIIGFDN+RQVQC+SFIA++P G Sbjct: 149 KKSYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A+VRIIGFDN+RQVQC+SFIA++P G Sbjct: 149 KKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 180
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A++RIIGFDN+RQVQC+SFIA++P G Sbjct: 149 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A++RIIGFDN+RQVQC+SFIA++P G Sbjct: 149 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPP 106 K EYP+A++RIIGFDN RQVQC+SFIA++PP Sbjct: 146 KTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPP 106 K EYP+A++RIIGFDN RQVQC+SFIA++PP Sbjct: 146 KTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 57.0 bits (136), Expect = 1e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 5 ARGKKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 A KKEYP A++RIIGFDN+RQVQC+ FIA RP G Sbjct: 143 AECKKEYPQAWIRIIGFDNVRQVQCIMFIASRPDG 177
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 57.0 bits (136), Expect = 1e-08 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 K YP+ ++RIIGFDN+RQVQC+SFIA++PPG Sbjct: 146 KTAYPNGFIRIIGFDNVRQVQCISFIAYKPPG 177
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A++RIIGFDN+RQVQC+SFIA++P G Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A++RIIGFDN+RQVQC+SFIA++P G Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A++RIIGFDN+RQVQC+SFIA++P G Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A++RIIGFDN+RQVQC+SFIA++P G Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 57.0 bits (136), Expect = 1e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KKEYP+A++RIIGFD+ RQVQCVSFIA++P G Sbjct: 148 KKEYPNAFIRIIGFDSNRQVQCVSFIAYKPAG 179
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A++RIIGFDN+RQVQC+SFIA++P G Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 57.0 bits (136), Expect = 1e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KKEYP A++RIIGFDN+RQVQC+SFIA +P G Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCISFIASKPGG 172
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 56.6 bits (135), Expect = 1e-08 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+A++RIIGFDN+RQVQCVSFIA++P Sbjct: 152 KKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 181
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 56.6 bits (135), Expect = 1e-08 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+A++RIIGFDN+RQVQCVSFIA++P Sbjct: 149 KKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 178
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A++RIIGFDN RQVQCVSFIA++P G Sbjct: 150 KKAYPSAFIRIIGFDNKRQVQCVSFIAYKPAG 181
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 56.6 bits (135), Expect = 1e-08 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 K YPDA+ R+IGFDN++Q QCVSFIA++PPG Sbjct: 138 KSYPDAFHRVIGFDNIKQTQCVSFIAYKPPG 168
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 56.6 bits (135), Expect = 1e-08 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+A++RIIGFDN+RQVQCVSFIA++P Sbjct: 148 KKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 177
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 56.2 bits (134), Expect = 2e-08 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP +++RIIGFDN+RQVQC+SFIA++P G Sbjct: 151 KKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 56.2 bits (134), Expect = 2e-08 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP +++RIIGFDN+RQVQC+SFIA++P G Sbjct: 151 KKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 56.2 bits (134), Expect = 2e-08 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+A++RIIGFDN+RQVQC+SFIA++P Sbjct: 149 KKAYPEAFIRIIGFDNVRQVQCISFIAYKP 178
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 56.2 bits (134), Expect = 2e-08 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPP 106 K YP+A++RIIGFDN+RQVQC+SFIA++PP Sbjct: 146 KTAYPNAFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 56.2 bits (134), Expect = 2e-08 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+A++RIIGFDN+RQVQC+SFIA++P Sbjct: 148 KKAYPEAFIRIIGFDNVRQVQCISFIAYKP 177
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 55.5 bits (132), Expect = 3e-08 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KKEYP A++RIIGFDN+RQVQC+SFIA +P Sbjct: 141 KKEYPQAWIRIIGFDNVRQVQCISFIASKP 170
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 55.5 bits (132), Expect = 3e-08 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK YP A++RIIGFDN RQVQ +SFIA++PPG Sbjct: 150 KKAYPSAFIRIIGFDNKRQVQIISFIAYKPPG 181
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 55.1 bits (131), Expect = 4e-08 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +2 Query: 2 SARGKKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 +A KKEYP A++R+IGFDN+RQVQCVSFI RP Sbjct: 145 AAECKKEYPAAFIRVIGFDNVRQVQCVSFIVERP 178
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 55.1 bits (131), Expect = 4e-08 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 K YP A++RIIGFDN+RQVQC+SFIA++P G Sbjct: 149 KNAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 55.1 bits (131), Expect = 4e-08 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+A+ RIIGFDN+RQVQC+SFIA++P Sbjct: 146 KKAYPEAFTRIIGFDNVRQVQCISFIAYKP 175
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 55.1 bits (131), Expect = 4e-08 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP A++RIIGFDN+RQVQC+SFIA++P Sbjct: 148 KKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 54.7 bits (130), Expect = 5e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 K YPDA+VRIIGFDN RQVQC+SFIA++P Sbjct: 147 KNAYPDAHVRIIGFDNKRQVQCISFIAYKP 176
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 54.7 bits (130), Expect = 5e-08 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 K YPD Y RIIGFDN+RQVQC+SF+A++P G Sbjct: 151 KAYPDCYGRIIGFDNVRQVQCISFLAYKPKG 181
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 54.7 bits (130), Expect = 5e-08 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPP 106 K YP+ ++RIIGFDN+RQVQC+SFIA++PP Sbjct: 146 KTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 54.7 bits (130), Expect = 5e-08 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPP 106 K YP+ ++RIIGFDN+RQVQC+SFIA++PP Sbjct: 146 KTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 54.3 bits (129), Expect = 7e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP A++RIIGFDN RQVQCVSFIA++P Sbjct: 151 KKAYPTAFIRIIGFDNKRQVQCVSFIAYKP 180
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 53.9 bits (128), Expect = 9e-08 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +2 Query: 2 SARGKKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 +A KKEYP A++R+IGFDN+RQVQCVSFI +P Sbjct: 145 AAECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 53.9 bits (128), Expect = 9e-08 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +2 Query: 2 SARGKKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 +A KKEYP A++R+IGFDN+RQVQCVSFI +P Sbjct: 145 AAECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 53.9 bits (128), Expect = 9e-08 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +2 Query: 2 SARGKKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 +A KKEYP A++R+IGFDN+RQVQCVSFI +P Sbjct: 145 AAECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 53.9 bits (128), Expect = 9e-08 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 K EYPD+++RIIGFDN+RQVQC+SFIA P Sbjct: 148 KAEYPDSFIRIIGFDNVRQVQCISFIAHTP 177
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 53.5 bits (127), Expect = 1e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +2 Query: 5 ARGKKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 A K EYP+A++RIIGFDN+RQVQC+SFIA P Sbjct: 143 AECKAEYPEAFIRIIGFDNVRQVQCISFIASTP 175
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+ +VRIIGFDN RQVQC+SFIA++P Sbjct: 147 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+ +VRIIGFDN RQVQC+SFIA++P Sbjct: 147 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+ +VRIIGFDN RQVQC+SFIA++P Sbjct: 147 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+ +VRIIGFDN RQVQC+SFIA++P Sbjct: 147 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+ +VRIIGFDN RQVQC+SFIA++P Sbjct: 147 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 KK YP+ +VRIIGFDN RQVQC+SFIA++P Sbjct: 143 KKAYPEYFVRIIGFDNKRQVQCISFIAYKP 172
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 53.1 bits (126), Expect = 2e-07 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPP 106 K YP +++RIIGFDN RQVQC+SFIA++PP Sbjct: 151 KTYPTSHIRIIGFDNKRQVQCISFIAYKPP 180
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 50.4 bits (119), Expect = 1e-06 Identities = 19/29 (65%), Positives = 26/29 (89%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 K YP+A++R+IGFDN+RQVQC+SFI +P Sbjct: 158 KAYPNAFIRVIGFDNVRQVQCISFIVHKP 186
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 50.1 bits (118), Expect = 1e-06 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 K YPD + RIIGFDN RQVQC+SF+ ++P G Sbjct: 147 KAYPDYFNRIIGFDNTRQVQCISFLTYKPEG 177
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 49.7 bits (117), Expect = 2e-06 Identities = 19/29 (65%), Positives = 25/29 (86%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 K YP A++R+IGFDN+RQVQC+SFI +P Sbjct: 142 KAYPKAFIRVIGFDNVRQVQCISFIVHKP 170
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +2 Query: 23 YPDAYVRIIGFDNLRQVQCVSFIAFRP 103 YP A+VRIIGFDN+RQVQC+SFIA P Sbjct: 151 YPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +2 Query: 23 YPDAYVRIIGFDNLRQVQCVSFIAFRP 103 YP A+VRIIGFDN+RQVQC+SFIA P Sbjct: 151 YPQAFVRIIGFDNVRQVQCISFIAHTP 177
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 48.5 bits (114), Expect = 4e-06 Identities = 20/32 (62%), Positives = 27/32 (84%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 KK PDA+VR IGF++ R+VQC+SFIA++P G Sbjct: 91 KKAPPDAFVRFIGFNDKREVQCISFIAYKPAG 122
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 48.1 bits (113), Expect = 5e-06 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = +2 Query: 23 YPDAYVRIIGFDNLRQVQCVSFIAFRP 103 YP+A+VR+IGF+N+RQVQC+SFIA P Sbjct: 107 YPEAFVRVIGFNNVRQVQCISFIAHTP 133
>RBS_SYNP2 (Q44178) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 111 Score = 45.4 bits (106), Expect = 3e-05 Identities = 16/30 (53%), Positives = 24/30 (80%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 + EY D Y+R++GFDN++Q Q VSFI ++P Sbjct: 77 RSEYSDCYIRVVGFDNIKQCQTVSFIVYKP 106
>RBS_PROHO (P27569) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 44.7 bits (104), Expect = 6e-05 Identities = 16/30 (53%), Positives = 24/30 (80%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 + EYP+ Y+R++GFDN++Q Q VSFI +P Sbjct: 77 RTEYPNCYIRVVGFDNIKQCQSVSFIVHKP 106
>RBS_SYNP6 (P04716) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 110 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 + EY D Y+R+ GFDN++Q Q VSFI RP Sbjct: 78 RSEYGDCYIRVAGFDNIKQCQTVSFIVHRP 107
>RBS_CYAPA (P18062) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 106 Score = 42.0 bits (97), Expect = 4e-04 Identities = 13/30 (43%), Positives = 26/30 (86%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 K+++P+AY+R++ FD++RQVQ + F+ ++P Sbjct: 76 KQQFPNAYIRVVAFDSIRQVQTLMFLVYKP 105
>RBS_SYNY3 (P54206) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 + E P+ Y+R+IGFDN++Q Q VSFI +P Sbjct: 77 RSENPNCYIRVIGFDNIKQCQTVSFIVHKP 106
>RBS_CHLMO (P17537) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 41.6 bits (96), Expect = 5e-04 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = +2 Query: 23 YPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 +P+ Y+R++ FDN++QVQC+ F+ RP E Sbjct: 128 FPNVYIRLVAFDNVKQVQCMGFLVQRPRNAAE 159
>RBS_EUGGR (P16881) Ribulose bisphosphate carboxylase small chains, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulose bisphosphate carboxylase small chain P2; Ribulose bispho Length = 1273 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 ++ YP YVR+ FD+++QVQ +SF+ RP G S Sbjct: 1093 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 1128 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 ++ YP YVR+ FD+++QVQ +SF+ RP G S Sbjct: 805 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 840 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 ++ YP YVR+ FD+++QVQ +SF+ RP G S Sbjct: 662 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 697 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 ++ YP YVR+ FD+++QVQ +SF+ RP G S Sbjct: 518 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 553 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 ++ YP YVR+ FD+++QVQ +SF+ RP G S Sbjct: 375 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 410 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 ++ YP YVR+ FD+++QVQ +SF+ RP G S Sbjct: 231 RRAYPQCYVRLAAFDSVKQVQVISFVVQRPSGSSSS 266 Score = 38.5 bits (88), Expect = 0.004 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 ++ YP YVR+ FD+++QVQ +SF+ RP Sbjct: 1237 RRAYPQCYVRLAAFDSVKQVQVISFVVQRP 1266 Score = 37.4 bits (85), Expect = 0.009 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXES 121 ++ YP YVR+ FD+++QVQ +SF+ RP G S Sbjct: 950 RRAYPQCYVRL-AFDSVKQVQVISFVVQRPSGSSSS 984
>RBS_ANASP (P06514) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 109 Score = 41.2 bits (95), Expect = 6e-04 Identities = 14/30 (46%), Positives = 23/30 (76%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 + +YP Y+R++GFDN++Q Q +SFI +P Sbjct: 77 RSQYPGHYIRVVGFDNIKQCQILSFIVHKP 106
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 40.8 bits (94), Expect = 8e-04 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 K +PDAYVR++ FDN +QVQ + F+ RP Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 40.8 bits (94), Expect = 8e-04 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 K +PDAYVR++ FDN +QVQ + F+ RP Sbjct: 143 KAFPDAYVRLVAFDNQKQVQIMGFLVQRP 171
>RBS7_ACECL (Q38693) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) (rbcS1) Length = 183 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 K +PDAY+R++ FD RQVQ F+ RPP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQICGFLVHRPPSATD 174
>RBS1_ACECL (P16129) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) (Fragment) Length = 126 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 K +PDAY+R++ FD RQVQ F+ RPP + Sbjct: 84 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 117
>RBS3_ACECL (P16131) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 K +PDAY+R++ FD RQVQ F+ RPP + Sbjct: 141 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS2_ACECL (P16130) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 86 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 K +PDAY+R++ FD RQVQ F+ RPP + Sbjct: 44 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 77
>RBS2_ACEME (P16135) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) (Fragment) Length = 173 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 K +PDAY+R++ FD RQVQ F+ RPP + Sbjct: 131 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 164
>RBS6_ACECL (Q38692) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) (rbcS4) Length = 182 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 K +PDAY+R++ FD RQVQ F+ RPP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS4_ACECL (P16132) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 K +PDAY+R++ FD RQVQ F+ RPP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS3_ACEME (P16136) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 182 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 K +PDAY+R++ FD RQVQ F+ RPP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS1_ACEME (P16134) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 K +PDAY+R++ FD RQVQ F+ RPP + Sbjct: 140 KAFPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS5_ACECL (P16133) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 184 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPP 106 K +PDAY+R++ FD RQVQ F+ RPP Sbjct: 142 KAFPDAYIRLVCFDANRQVQISGFLVHRPP 171
>RBS_MARPA (O64416) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +2 Query: 11 GKKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 GKK Y+R +GFDN RQVQC SFI +P Sbjct: 152 GKK----CYIRCLGFDNTRQVQCASFIVHQP 178
>RBS5_ACEME (P16138) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 183 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 23 YPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 +PDAY+R++ FD RQVQ F+ RPP + Sbjct: 143 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 174
>RBS4_ACEME (P16137) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 182 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 23 YPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 +PDAY+R++ FD RQVQ F+ RPP + Sbjct: 142 FPDAYIRLVCFDANRQVQISGFLVHRPPSATD 173
>RBS_BATOE (P26985) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPPGCXE 118 K +PDAY+R++ FD RQVQ F+ RP + Sbjct: 133 KAFPDAYIRLVCFDANRQVQISGFLVHRPESATD 166
>RBS_SACHY (Q41373) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 168 Score = 35.0 bits (79), Expect = 0.044 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = +2 Query: 23 YPDAYVRIIGFDNLRQVQCVSFIAFRPPG 109 YP+ I+GFDN+RQ Q ++FIA++P G Sbjct: 139 YPELRA-ILGFDNIRQTQWLTFIAYKPAG 166
>RBS2_CHRVI (P22860) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 113 Score = 33.9 bits (76), Expect = 0.098 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 ++ YPD +VR++G+D Q + SF+A RP Sbjct: 83 RRSYPDHHVRLVGYDTYAQSKGHSFLAHRP 112
>RBS_PSEHY (Q51857) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 124 Score = 33.1 bits (74), Expect = 0.17 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQCVSFIAFRP 103 K+ P+ +++IG+DN+RQ Q + + +RP Sbjct: 93 KRSNPNHLIKLIGYDNIRQTQGTAMLVYRP 122
>RBS_ALVHS (P24682) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 121 Score = 32.0 bits (71), Expect = 0.37 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFRPP 106 K +P +VR+IG+DN Q Q + + FR P Sbjct: 87 KAHPSHHVRLIGYDNYAQSQGTAMVIFRGP 116
>RBS_NITVU (Q59614) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 108 Score = 31.6 bits (70), Expect = 0.49 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFR 100 +E+PD VR + +DN Q Q ++F+ +R Sbjct: 81 REFPDQMVRFVAYDNYAQSQGMAFVVYR 108
>RBS2_THIFE (Q07088) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 118 Score = 31.2 bits (69), Expect = 0.64 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 8 RGKKEYPDAYVRIIGFDNLRQVQCVSFIAFR 100 R K P +VRI+G+DN +Q Q S + +R Sbjct: 84 RCHKRNPHNHVRIVGYDNFKQSQGTSLVVYR 114
>RBS_GUITH (P14960) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 139 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQ--CVSFIAFRP 103 +K P YV++ FDN R V+ C+SFI RP Sbjct: 72 RKAKPACYVKVNAFDNSRGVESCCLSFIVQRP 103
>RBS_PORAE (Q09125) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 138 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = +2 Query: 14 KKEYPDAYVRIIGFDNLRQVQ--CVSFIAFRP 103 +K P+ Y+++ FDN R V+ C+SFI RP Sbjct: 72 RKAKPNYYIKVNAFDNTRGVESCCLSFIINRP 103
>RBS_SYNPX (P0A4S5) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAF 97 + YPD +VRI+G+D Q Q F+ F Sbjct: 84 RAYPDHHVRIVGYDAYTQSQGACFVVF 110
>RBS_SYNPW (P0A4S6) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 113 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAF 97 + YPD +VRI+G+D Q Q F+ F Sbjct: 84 RAYPDHHVRIVGYDAYTQSQGACFVVF 110
>RBS1_CHRVI (P22850) Ribulose bisphosphate carboxylase small chain 1 (EC| 4.1.1.39) (RuBisCO small subunit 1) Length = 117 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFR 100 K +P+ +VR+IGFDN Q + + +R Sbjct: 86 KAHPNNHVRLIGFDNYAQSKGAEMVVYR 113
>HUTG_RALSO (Q8XW30) Formimidoylglutamase (EC 3.5.3.8) (Formiminoglutamase)| (Formiminoglutamate hydrolase) Length = 325 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 106 RWPEGDEADALHLPQVVEADD 44 RW DE D LHLP+V++ D Sbjct: 212 RWLRDDEMDLLHLPRVLQTVD 232
>RBS_THIDA (Q56260) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 118 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 17 KEYPDAYVRIIGFDNLRQVQCVSFIAFR 100 K P+ +VR++G+DN Q Q + + +R Sbjct: 87 KANPNNHVRLVGYDNFAQSQGAAMVIYR 114
>RBS_BRAJA (Q9ZI33) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 134 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +2 Query: 5 ARGKKEYPDAYVRIIGFDNLRQVQCV--SFIAFRPP 106 A ++ Y D Y+RI GFD+ + V SF+ RPP Sbjct: 69 AECRRVYGDRYIRISGFDSSPGWESVRISFLVNRPP 104
>RBS2_HYDMR (Q59461) Ribulose bisphosphate carboxylase small chain 2 (EC| 4.1.1.39) (RuBisCO small subunit 2) Length = 122 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 23 YPDAYVRIIGFDNLRQVQCVSFIAFRPPG-CXESG 124 YP+ +R+IG+DN Q Q +F F G C G Sbjct: 84 YPNHMIRLIGYDNYTQCQGHNFCRFTVLGECNSHG 118
>GLDSA_STRRY (Q2MFP2) L-glutamine:2-deoxy-scyllo-inosose aminotransferase (EC| 2.6.1.-) (L-glutamine:DOI aminotransferase) (L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase) (L-glutamine:amino-DOI aminotransferase) Length = 424 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 13 QEGVP*RLRPYHRLRQPAAGAVRQLHRLQATG 108 Q G P R RP+ QPA GAVR L + +G Sbjct: 8 QGGSPVRTRPWPLWPQPAPGAVRALDGVLTSG 39
>RBS_RHOCA (O32741) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 118 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 26 PDAYVRIIGFDNLRQVQCVSFIAFR 100 P +VR+IG+DN Q Q + I +R Sbjct: 90 PGHHVRLIGYDNFTQSQGANMIVYR 114
>FENR_BUCAP (Q9Z615) Ferredoxin--NADP reductase (EC 1.18.1.2) (FNR) (Flavodoxin| reductase) (FLXR) (FLDR) Length = 257 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -1 Query: 302 VGRARIYICIYAPQPMLVQTQIIEKKIML 216 V R + + +Y P+L+Q QI+EKKI L Sbjct: 181 VSREKNHNSLYGRIPLLLQNQILEKKIGL 209 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,505,044 Number of Sequences: 219361 Number of extensions: 887712 Number of successful extensions: 1875 Number of sequences better than 10.0: 130 Number of HSP's better than 10.0 without gapping: 1855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1875 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)