Clone Name | baak0a03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PPF1_PEA (Q9FY06) Inner membrane protein PPF-1, chloroplast prec... | 29 | 5.7 |
---|
>PPF1_PEA (Q9FY06) Inner membrane protein PPF-1, chloroplast precursor| (Post-floral-specific protein 1) Length = 442 Score = 29.3 bits (64), Expect = 5.7 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +3 Query: 285 GHEKSVDAPQAPCNIAYIYTPKTAHDLLYWNHSSLYMVLTSLYLACMYKS 434 G S+ A Q+ I++++ H LL W ++ Y+VL L + Y S Sbjct: 224 GGPTSIAARQSGSGISWLFPFVDGHPLLGWYDTAAYLVLPVLLIVSQYVS 273 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,648,289 Number of Sequences: 219361 Number of extensions: 1071309 Number of successful extensions: 2997 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2996 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)