>PPF1_PEA (Q9FY06) Inner membrane protein PPF-1, chloroplast precursor|
           (Post-floral-specific protein 1)
          Length = 442

 Score = 29.3 bits (64), Expect = 5.7
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +3

Query: 285 GHEKSVDAPQAPCNIAYIYTPKTAHDLLYWNHSSLYMVLTSLYLACMYKS 434
           G   S+ A Q+   I++++     H LL W  ++ Y+VL  L +   Y S
Sbjct: 224 GGPTSIAARQSGSGISWLFPFVDGHPLLGWYDTAAYLVLPVLLIVSQYVS 273


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 59,648,289
Number of Sequences: 219361
Number of extensions: 1071309
Number of successful extensions: 2997
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2917
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2996
length of database: 80,573,946
effective HSP length: 103
effective length of database: 57,979,763
effective search space used: 3304846491
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)